Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PIK3CG Rabbit pAb (A6688)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PIK3CG Rabbit pAb (A6688)

Western blot analysis of extracts of various cell lines, using PIK3CG antibody (A6688) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - PIK3CG Rabbit pAb (A6688)

Immunohistochemistry analysis of paraffin-embedded rat spleen using PIK3CG Rabbit pAb (A6688) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PIK3CG Rabbit pAb (A6688)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PIK3CG Rabbit pAb (A6688) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PIK3CG Rabbit pAb (A6688)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using PIK3CG Rabbit pAb (A6688) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of Jurkat cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of NIH/3T3 cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of PC-12 cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of U2OS cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PIK3CG Rabbit pAb
Catalog No. A6688
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-342 of human PIK3CG (NP_002640.2).
Sequence RSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIH
Gene ID 5294
Swiss prot P48736
Synonyms PI3K; PIK3; IMD97; PI3CG; PI3Kgamma; p110gamma; p120-PI3K; PIK3CG
Calculated MW 126kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Jurkat, K-562, Mouse thymus
Cellular location Cell membrane, Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PIK3CG Rabbit pAb images

ABclonal:Western blot - PIK3CG Rabbit pAb (A6688)}

Western blot - PIK3CG Rabbit pAb (A6688)

Western blot analysis of extracts of various cell lines, using PIK3CG antibody (A6688) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - PIK3CG Rabbit pAb (A6688)}

Immunohistochemistry - PIK3CG Rabbit pAb (A6688)

Immunohistochemistry analysis of paraffin-embedded rat spleen using PIK3CG Rabbit pAb (A6688) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PIK3CG Rabbit pAb (A6688)}

Immunohistochemistry - PIK3CG Rabbit pAb (A6688)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PIK3CG Rabbit pAb (A6688) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PIK3CG Rabbit pAb (A6688)}

Immunohistochemistry - PIK3CG Rabbit pAb (A6688)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using PIK3CG Rabbit pAb (A6688) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)}

Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of Jurkat cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)}

Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of NIH/3T3 cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)}

Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of PC-12 cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PIK3CG Rabbit pAb (A6688)}

Immunofluorescence - PIK3CG Rabbit pAb (A6688)

Immunofluorescence analysis of U2OS cells using PIK3CG Rabbit pAb (A6688) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6688 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PIK3CG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PIK3CG. (Distance between topics and target gene indicate popularity.) PIK3CG

* Data provided by citexs.com, for reference only.

Publishing research using A6688? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order