Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PIK3C3/VPS34 Rabbit mAb (A12295)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - PIK3C3/VPS34 Rabbit mAb (A12295)

Western blot analysis of various lysates using PIK3C3/VPS34 Rabbit mAb (A12295) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - PIK3C3/VPS34 Rabbit mAb (A12295)

Immunofluorescence analysis of NIH-3T3 cells using PIK3C3/VPS34 Rabbit mAb (A12295) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - PIK3C3/VPS34 Rabbit mAb (A12295)

Immunoprecipitation analysis of 600 μg extracts of Rat brain cells using 3 μg PIK3C3/VPS34 antibody (A12295). Western blot was performed from the immunoprecipitate using PIK3C3/VPS34 antibody (A12295) at a dilution of 1:500.

You may also interested in:

Overview

Product name PIK3C3/VPS34 Rabbit mAb
Catalog No. A12295
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0286

Background

Enables 1-phosphatidylinositol-3-kinase activity. Involved in early endosome to late endosome transport and regulation of cytokinesis. Acts upstream of or within autophagy and protein lipidation. Located in autolysosome; late endosome; and midbody.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 788-887 of human PIK3C3/VPS34 (Q8NEB9).
Sequence GGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
Gene ID 5289
Swiss prot Q8NEB9
Synonyms VPS34; Vps34; hVps34; PIK3C3/VPS34
Calculated MW 102kDa
Observed MW 100kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
IF/ICC Mouse
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples RD, Mouse brain, Rat brain
Cellular location Cytoplasmic vesicle, Late endosome, Midbody, autophagosome
Customer validation

WB (Homo sapiens)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PIK3C3/VPS34 Rabbit mAb images

ABclonal:Western blot - PIK3C3/VPS34 Rabbit mAb (A12295)}

Western blot - PIK3C3/VPS34 Rabbit mAb (A12295)

Western blot analysis of various lysates using PIK3C3/VPS34 Rabbit mAb (A12295) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - PIK3C3/VPS34 Rabbit mAb (A12295)}

Immunofluorescence - PIK3C3/VPS34 Rabbit mAb (A12295)

Immunofluorescence analysis of NIH-3T3 cells using PIK3C3/VPS34 Rabbit mAb (A12295) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - PIK3C3/VPS34 Rabbit mAb (A12295)}

Immunoprecipitation - PIK3C3/VPS34 Rabbit mAb (A12295)

Immunoprecipitation analysis of 600 μg extracts of Rat brain cells using 3 μg PIK3C3/VPS34 antibody (A12295). Western blot was performed from the immunoprecipitate using PIK3C3/VPS34 antibody (A12295) at a dilution of 1:500.

Inquire About This Product

Submit your question about A12295 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PIK3C3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PIK3C3. (Distance between topics and target gene indicate popularity.) PIK3C3

* Data provided by citexs.com, for reference only.

Publishing research using A12295? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order