Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PI3 Kinase p110 delta Rabbit mAb (A19742)

Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PI3 Kinase p110 delta Rabbit mAb (A19742)

Western blot analysis of extracts of Mouse thymus, using PI3 Kinase p110 delta Rabbit mAb (A19742) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - PI3 Kinase p110 delta Rabbit mAb (A19742)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using PI3 Kinase p110 delta Rabbit mAb (A19742) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PI3 Kinase p110 delta Rabbit mAb (A19742)

Immunohistochemistry analysis of paraffin-embedded rat spleen using PI3 Kinase p110 delta Rabbit mAb (A19742) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name PI3 Kinase p110 delta Rabbit mAb
Catalog No. A19742
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2268

Background

Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I PI3K found primarily in leukocytes. Like other class I PI3Ks (p110-alpha p110-beta, and p110-gamma), the encoded protein binds p85 adapter proteins and GTP-bound RAS. However, unlike the other class I PI3Ks, this protein phosphorylates itself, not p85 protein.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PI3 Kinase p110 delta (O00329).
Sequence EESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
Gene ID 5293
Swiss prot O00329
Synonyms APDS; PI3K; IMD14; p110D; IMD14A; IMD14B; ROCHIS; P110DELTA; PI3 Kinase p110 delta
Calculated MW 119kDa
Observed MW 119kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouse
IHC-P MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse thymus
Cellular location cytoplasm, cytosol, plasma membrane
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus)

WB;IP (Homo sapiens)

IHC (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PI3 Kinase p110 delta Rabbit mAb images

ABclonal:Western blot - PI3 Kinase p110 delta Rabbit mAb (A19742)}

Western blot - PI3 Kinase p110 delta Rabbit mAb (A19742)

Western blot analysis of extracts of Mouse thymus, using PI3 Kinase p110 delta Rabbit mAb (A19742) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - PI3 Kinase p110 delta Rabbit mAb (A19742)}

Immunohistochemistry - PI3 Kinase p110 delta Rabbit mAb (A19742)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using PI3 Kinase p110 delta Rabbit mAb (A19742) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PI3 Kinase p110 delta Rabbit mAb (A19742)}

Immunohistochemistry - PI3 Kinase p110 delta Rabbit mAb (A19742)

Immunohistochemistry analysis of paraffin-embedded rat spleen using PI3 Kinase p110 delta Rabbit mAb (A19742) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19742 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PIK3CD. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PIK3CD. (Distance between topics and target gene indicate popularity.) PIK3CD

* Data provided by citexs.com, for reference only.

Publishing research using A19742? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order