Publications (9) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Western blot analysis of extracts of Mouse thymus, using PI3 Kinase p110 delta Rabbit mAb (A19742) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using PI3 Kinase p110 delta Rabbit mAb (A19742) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
| Product name | PI3 Kinase p110 delta Rabbit mAb |
|---|---|
| Catalog No. | A19742 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2268 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PI3 Kinase p110 delta (O00329). |
|---|---|
| Sequence | EESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR |
| Gene ID | 5293 |
| Swiss prot | O00329 |
| Synonyms | APDS; PI3K; IMD14; p110D; IMD14A; IMD14B; ROCHIS; P110DELTA; PI3 Kinase p110 delta |
| Calculated MW | 119kDa |
| Observed MW | 119kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | Testing results |
| WB | |
| IHC-P | |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Application key | Western blotting Immunohistochemistry |
| Positive samples | Mouse thymus |
| Cellular location | cytoplasm, cytosol, plasma membrane |
| Customer validation | WB (Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus) WB;IP (Homo sapiens) IHC (Homo sapiens) IF (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19742 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PIK3CD. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PIK3CD. (Distance between topics and target gene indicate popularity.) PIK3CD
* Data provided by citexs.com, for reference only.
Publishing research using A19742? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
_WB_01.jpg?t=1701998521)
