Publications (10) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Rat
Western blot analysis of various lysates, using PI3 Kinase p110 beta Rabbit pAb (A0982) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates, using PI3 Kinase p110 beta Rabbit pAb (A0982) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180S.
| Product name | PI3 Kinase p110 beta Rabbit pAb |
|---|---|
| Catalog No. | A0982 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1). |
|---|---|
| Sequence | KVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK |
| Gene ID | 5291 |
| Swiss prot | P42338 |
| Synonyms | PI3K; PIK3C1; P110BETA; PI3KBETA; PI3 Kinase p110 beta |
| Calculated MW | 123kDa |
| Observed MW | 110kDa |
| Reactivity | Human, Rat |
|---|---|
| Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting |
| Positive samples | K-562, 293F, Rat brain, Rat lung |
| Cellular location | Cytoplasm, Nucleus |
| Customer validation | WB (Homo sapiens, Mus musculus, hsa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A0982 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PIK3CB. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PIK3CB. (Distance between topics and target gene indicate popularity.) PIK3CB
* Data provided by citexs.com, for reference only.
Publishing research using A0982? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
_WB_01.jpg?t=1701998521)
