Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PI3 Kinase p110 beta Rabbit pAb (A0982)

Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - PI3 Kinase p110 beta Rabbit pAb (A0982)

Western blot analysis of various lysates, using PI3 Kinase p110 beta Rabbit pAb (A0982) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - PI3 Kinase p110 beta Rabbit pAb (A0982)

Western blot analysis of various lysates, using PI3 Kinase p110 beta Rabbit pAb (A0982) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180S.

You may also interested in:

Overview

Product name PI3 Kinase p110 beta Rabbit pAb
Catalog No. A0982
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1).
Sequence KVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
Gene ID 5291
Swiss prot P42338
Synonyms PI3K; PIK3C1; P110BETA; PI3KBETA; PI3 Kinase p110 beta
Calculated MW 123kDa
Observed MW 110kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples K-562, 293F, Rat brain, Rat lung
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Mus musculus, hsa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PI3 Kinase p110 beta Rabbit pAb images

ABclonal:Western blot - PI3 Kinase p110 beta Rabbit pAb (A0982)}

Western blot - PI3 Kinase p110 beta Rabbit pAb (A0982)

Western blot analysis of various lysates, using PI3 Kinase p110 beta Rabbit pAb (A0982) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - PI3 Kinase p110 beta Rabbit pAb (A0982)}

Western blot - PI3 Kinase p110 beta Rabbit pAb (A0982)

Western blot analysis of various lysates, using PI3 Kinase p110 beta Rabbit pAb (A0982) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180S.

Inquire About This Product

Submit your question about A0982 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PIK3CB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PIK3CB. (Distance between topics and target gene indicate popularity.) PIK3CB

* Data provided by citexs.com, for reference only.

Publishing research using A0982? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order