Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PHLPP2 Rabbit pAb (A18218)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PHLPP2 Rabbit pAb (A18218)

Western blot analysis of various lysates using PHLPP2 Rabbit pAb (A18218) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - PHLPP2 Rabbit pAb (A18218)

Immunofluorescence analysis of L929 cells using PHLPP2 Rabbit pAb (A18218) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PHLPP2 Rabbit pAb
Catalog No. A18218
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable protein serine/threonine phosphatase activity. Predicted to be involved in signal transduction. Located in several cellular components, including intercellular bridge; mitotic spindle; and nucleoplasm.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1250-1323 of human PHLPP2 (NP_055835.2).
Sequence DSLNLIEVATEVPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL
Gene ID 23035
Swiss prot Q6ZVD8
Synonyms PPM3B; PHLPPL; PHLPP2
Calculated MW 147kDa
Observed MW 140kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse eye, Rat eye
Cellular location cytoplasm, cytosol, intercellular bridge, mitotic spindle, nucleoplasm, photoreceptor outer segment membrane
Customer validation

IF (Mus musculus)

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PHLPP2 Rabbit pAb images

ABclonal:Western blot - PHLPP2 Rabbit pAb (A18218)}

Western blot - PHLPP2 Rabbit pAb (A18218)

Western blot analysis of various lysates using PHLPP2 Rabbit pAb (A18218) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - PHLPP2 Rabbit pAb (A18218)}

Immunofluorescence - PHLPP2 Rabbit pAb (A18218)

Immunofluorescence analysis of L929 cells using PHLPP2 Rabbit pAb (A18218) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A18218 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PHLPP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PHLPP2. (Distance between topics and target gene indicate popularity.) PHLPP2

* Data provided by citexs.com, for reference only.

Publishing research using A18218? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order