Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PHGDH Rabbit pAb (A10461)

Review (1) Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PHGDH Rabbit pAb (A10461)

Western blot analysis of various lysates using PHGDH Rabbit pAb (A10461) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - PHGDH Rabbit pAb (A10461)

Immunofluorescence analysis of HeLa cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PHGDH Rabbit pAb (A10461)

Immunofluorescence analysis of NIH/3T3 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PHGDH Rabbit pAb (A10461)

Immunofluorescence analysis of PC-12 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - PHGDH Rabbit pAb (A10461)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg PHGDH antibody (A10461). Western blot was performed from the immunoprecipitate using PHGDH antibody (A10461) at a dilution of 1:1000.

Review
ABclonal: review for PHGDH Rabbit pAb(A10461)

You may also interested in:

Overview

Product name PHGDH Rabbit pAb
Catalog No. A10461
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the enzyme which is involved in the early steps of L-serine synthesis in animal cells. L-serine is required for D-serine and other amino acid synthesis. The enzyme requires NAD/NADH as a cofactor and forms homotetramers for activity. Mutations in this gene have been found in a family with congenital microcephaly, psychomotor retardation and other symptoms. Multiple alternatively spliced transcript variants have been found, however the full-length nature of most are not known.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 264-533 of human PHGDH (NP_006614.2).
Sequence EEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Gene ID 26227
Swiss prot O43175
Synonyms NLS; PDG; PGD; NLS1; PGAD; PGDH; SERA; 3PGDH; 3-PGDH; PHGDHD; HEL-S-113; PHGDH
Calculated MW 57kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:100 - 1:500
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, HT-29, MCF7, NIH/3T3, C6, Mouse brain
Cellular location cytosol, extracellular exosome
Customer validation

(PC-3 HEPG2 HELA MOLT4 A549 JURKAT 293T RPMI-8226)

WB (Homo sapiens, Mus musculus)

Neutralization assays (Bombyx mori Linnaeus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PHGDH Rabbit pAb images

ABclonal:Western blot - PHGDH Rabbit pAb (A10461)}

Western blot - PHGDH Rabbit pAb (A10461)

Western blot analysis of various lysates using PHGDH Rabbit pAb (A10461) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - PHGDH Rabbit pAb (A10461)}

Immunofluorescence - PHGDH Rabbit pAb (A10461)

Immunofluorescence analysis of HeLa cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PHGDH Rabbit pAb (A10461)}

Immunofluorescence - PHGDH Rabbit pAb (A10461)

Immunofluorescence analysis of NIH/3T3 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PHGDH Rabbit pAb (A10461)}

Immunofluorescence - PHGDH Rabbit pAb (A10461)

Immunofluorescence analysis of PC-12 cells using PHGDH Rabbit pAb (A10461) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - PHGDH Rabbit pAb (A10461)}

Immunoprecipitation - PHGDH Rabbit pAb (A10461)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg PHGDH antibody (A10461). Western blot was performed from the immunoprecipitate using PHGDH antibody (A10461) at a dilution of 1:1000.

Submit an review for A10461

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A10461 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PHGDH. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PHGDH. (Distance between topics and target gene indicate popularity.) PHGDH

* Data provided by citexs.com, for reference only.

Publishing research using A10461? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order