Reviews (2)Publications (25) Datasheet
Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using PGC1α antibody (A12348) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of various cell lines, using PGC1α antibody (A12348) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry of paraffin-embedded human liver using PGC1α Rabbit pAb (A12348) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using PGC1α Rabbit pAb (A12348) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | PGC1α Rabbit pAb |
|---|---|
| Catalog No. | A12348 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 610-798 of human PGC1α (NP_037393.1). |
|---|---|
| Sequence | HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR |
| Gene ID | 10891 |
| Swiss prot | Q9UBK2 |
| Synonyms | PPARGC1A; LEM6; PGC-1(alpha); PGC-1alpha; PGC-1v; PGC1; PGC1A; PPARGC1; PPARG coactivator 1 alpha; PGC1 alpha |
| Calculated MW | 14kDa/30kDa/31kDa/33kDa/77kDa/89kDa/91kDa |
| Observed MW | 91KDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
| Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, HepG2, Mouse heart, Mouse skeletal muscle, Rat heart |
| Cellular location | Cytoplasm, Nucleus, PML body |
| Customer validation | (mouse cells, Rabbit cerebral microvascular endothelial cells) WB(Rattus norvegicus, Homo sapiens, Mus musculus, Gallus gallus, Hordeum vulgare) IF(Rattus norvegicus) IHC(Homo sapiens, Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A12348 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A12348? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
