Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PEPCK/PCK2 Rabbit pAb (A8446)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PEPCK/PCK2 Rabbit pAb (A8446)

Western blot analysis of lysates from Hep G2 cells using PEPCK/PCK2 Rabbit pAb(A8446) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - PEPCK/PCK2 Rabbit pAb (A8446)

Western blot analysis of various lysates using PEPCK/PCK2 Rabbit pAb (A8446) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 90s.

You may also interested in:

Overview

Product name PEPCK/PCK2 Rabbit pAb
Catalog No. A8446
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of guanosine triphosphate (GTP). A cytosolic form of this protein is encoded by a different gene and is the key enzyme of gluconeogenesis in the liver. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PEPCK/PCK2 (NP_004554.2).
Sequence MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVQLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLA
Gene ID 5106
Swiss prot Q16822
Synonyms PEPCK; PEPCK2; PEPCK-M; PEPCK/PCK2
Calculated MW 71kDa
Observed MW 69kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Hep G2, Mouse brain, Rat brain
Cellular location Mitochondrion
Customer validation

WB (Homo sapiens, Mus musculus, Crassostrea gigas)

IHC (Mus musculus, Crassostrea gigas)

IF (Crassostrea gigas)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PEPCK/PCK2 Rabbit pAb images

ABclonal:Western blot - PEPCK/PCK2 Rabbit pAb (A8446)}

Western blot - PEPCK/PCK2 Rabbit pAb (A8446)

Western blot analysis of lysates from Hep G2 cells using PEPCK/PCK2 Rabbit pAb(A8446) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - PEPCK/PCK2 Rabbit pAb (A8446)}

Western blot - PEPCK/PCK2 Rabbit pAb (A8446)

Western blot analysis of various lysates using PEPCK/PCK2 Rabbit pAb (A8446) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 90s.

Inquire About This Product

Submit your question about A8446 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PCK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PCK2. (Distance between topics and target gene indicate popularity.) PCK2

* Data provided by citexs.com, for reference only.

Publishing research using A8446? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order