Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PEDF/SERPINF1 Rabbit pAb (A11782)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PEDF/SERPINF1 Rabbit pAb (A11782)

Western blot analysis of various lysates using PEDF/SERPINF1 Rabbit pAb (A11782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name PEDF/SERPINF1 Rabbit pAb
Catalog No. A11782
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the serpin family that does not display the serine protease inhibitory activity shown by many of the other serpin proteins. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 141-240 of human PEDF/SERPINF1 (NP_002606.3).
Sequence RIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR
Gene ID 5176
Swiss prot P36955
Synonyms OI6; OI12; PEDF; EPC-1; PIG35; PEDF/SERPINF1
Calculated MW 46kDa
Observed MW 46kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Human plasma, Mouse liver, Rat liver
Cellular location Melanosome, Secreted
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PEDF/SERPINF1 Rabbit pAb images

ABclonal:Western blot - PEDF/SERPINF1 Rabbit pAb (A11782)}

Western blot - PEDF/SERPINF1 Rabbit pAb (A11782)

Western blot analysis of various lysates using PEDF/SERPINF1 Rabbit pAb (A11782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A11782 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SERPINF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SERPINF1. (Distance between topics and target gene indicate popularity.) SERPINF1

* Data provided by citexs.com, for reference only.

Publishing research using A11782? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order