Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PEBP1 Rabbit mAb (A12768)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PEBP1 Rabbit mAb (A12768)

Western blot analysis of extracts of various cell lines, using PEBP1 Rabbit mAb (A12768) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review
ABclonal: review for PEBP1 Rabbit mAb(A12768)

You may also interested in:

Overview

Product name PEBP1 Rabbit mAb
Catalog No. A12768
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0704

Background

This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086).
Sequence MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG
Gene ID 5037
Swiss prot P30086
Synonyms PBP; HCNP; PEBP; RKIP; HCNPpp; PEBP-1; HEL-210; HEL-S-34; HEL-S-96; PEBP1
Calculated MW 21kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, Mouse liver, Mouse brain, Mouse thymus, Rat liver, Rat brain, Rat thymus
Cellular location Cytoplasm
Customer validation

(293T、T47D、SKVO-3、MOLT-4、HepG2、PC-3)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PEBP1 Rabbit mAb images

ABclonal:Western blot - PEBP1 Rabbit mAb (A12768)}

Western blot - PEBP1 Rabbit mAb (A12768)

Western blot analysis of extracts of various cell lines, using PEBP1 Rabbit mAb (A12768) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Submit an review for A12768

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A12768 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PEBP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PEBP1. (Distance between topics and target gene indicate popularity.) PEBP1

* Data provided by citexs.com, for reference only.

Publishing research using A12768? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order