Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PDGFRB Rabbit mAb (A19531)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - PDGFRB Rabbit mAb (A19531)

Western blot analysis of various lysates using PDGFRB Rabbit mAb (A19531) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - PDGFRB Rabbit mAb (A19531)

Confocal imaging of NIH/3T3 cells using PDGFRB Rabbit mAb (A19531, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

You may also interested in:

Overview

Product name PDGFRB Rabbit mAb
Catalog No. A19531
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0009

Background

The protein encoded by this gene is a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer (PDGFB or PDGFD) or a heterodimer (PDGFA and PDGFB). This gene is essential for normal development of the cardiovascular system and aids in rearrangement of the actin cytoskeleton. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the ETV6 gene, results in chronic myeloproliferative disorder with eosinophilia.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000-1106 of human PDGFRB (P09619).
Sequence SPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL
Gene ID 5159
Swiss prot P09619
Synonyms IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1; PDGFRB
Calculated MW 124kDa
Observed MW 170kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
IF/ICC Mouse
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples SH-SY5Y, Mouse lung, Mouse heart, NIH/3T3
Cellular location Cell membrane, Cytoplasmic vesicle, Lysosome lumen, Single-pass type I membrane protein
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PDGFRB Rabbit mAb images

ABclonal:Western blot - PDGFRB Rabbit mAb (A19531)}

Western blot - PDGFRB Rabbit mAb (A19531)

Western blot analysis of various lysates using PDGFRB Rabbit mAb (A19531) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - PDGFRB Rabbit mAb (A19531)}

Immunofluorescence - PDGFRB Rabbit mAb (A19531)

Confocal imaging of NIH/3T3 cells using PDGFRB Rabbit mAb (A19531, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Inquire About This Product

Submit your question about A19531 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PDGFRB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PDGFRB. (Distance between topics and target gene indicate popularity.) PDGFRB

* Data provided by citexs.com, for reference only.

Publishing research using A19531? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Proteins (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order