Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PARP1 Rabbit pAb (A11010)

Publications (3) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - PARP1 Rabbit pAb (A11010)

Western blot analysis of extracts of various cell lines, using PARP1 antibody (A11010) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 20s.

You may also interested in:

Overview

Product name PARP1 Rabbit pAb
Catalog No. A11010
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2).
Sequence PGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
Gene ID 142
Swiss prot P09874
Synonyms PARP; PARS; PPOL; ADPRT; ARTD1; ADPRT1; PARP-1; ADPRT 1; pADPRT-1; Poly-PARP; PARP1
Calculated MW 113kDa
Observed MW 120kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, 293T, BT-474, Mouse thymus
Cellular location Nucleus, nucleolus
Customer validation

WB (Homo sapiens, Mus musculus, Gallus gallus)

Research Area

PARP1 Rabbit pAb images

ABclonal:Western blot - PARP1 Rabbit pAb (A11010)}

Western blot - PARP1 Rabbit pAb (A11010)

Western blot analysis of extracts of various cell lines, using PARP1 antibody (A11010) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 20s.

Inquire About This Product

Submit your question about A11010 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PARP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PARP1. (Distance between topics and target gene indicate popularity.) PARP1

* Data provided by citexs.com, for reference only.

Publishing research using A11010? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order