Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PARD6A Rabbit pAb (A12755)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Rat

ABclonal:Western blot - PARD6A Rabbit pAb (A12755)

Western blot analysis of extracts of rat skeletal muscle, using PARD6A antibody (A12755) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.

You may also interested in:

Overview

Product name PARD6A Rabbit pAb
Catalog No. A12755
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 256-345 of human PARD6A (NP_001032358.1).
Sequence RGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL
Gene ID 50855
Swiss prot Q9NPB6
Synonyms PAR6; PAR6C; TAX40; PAR-6A; TIP-40; PAR6alpha; PARD6A
Calculated MW 37kDa
Observed MW 37kDa

Applications

Reactivity Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat skeletal muscle
Cellular location Cell junction, Cell membrane, Cell projection, Cytoplasm, ruffle, tight junction

Research Area

PARD6A Rabbit pAb images

ABclonal:Western blot - PARD6A Rabbit pAb (A12755)}

Western blot - PARD6A Rabbit pAb (A12755)

Western blot analysis of extracts of rat skeletal muscle, using PARD6A antibody (A12755) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.

Inquire About This Product

Submit your question about A12755 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PARD6A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PARD6A. (Distance between topics and target gene indicate popularity.) PARD6A

* Data provided by citexs.com, for reference only.

Publishing research using A12755? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order