Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PAPD5 Rabbit pAb (A15885)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PAPD5 Rabbit pAb (A15885)

Western blot analysis of various lysates using PAPD5 Rabbit pAb (A15885) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name PAPD5 Rabbit pAb
Catalog No. A15885
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables guanylyltransferase activity and polynucleotide adenylyltransferase activity. Involved in several processes, including RNA metabolic process; negative regulation of telomere maintenance via telomerase; and regulation of mRNA stability. Located in cytoplasm and nucleolus. Part of TRAMP complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 480-590 of human PAPD5 (NP_001035374.2).
Sequence YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVSSSSATQSSSSDVDSDAT
Gene ID 64282
Swiss prot Q8NDF8
Synonyms TUT3; PAPD5; TRF4-2
Calculated MW 63kDa
Observed MW 90kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, Mouse liver, Rat thymus
Cellular location Cytoplasm, Nucleus, nucleolus

Research Area

PAPD5 Rabbit pAb images

ABclonal:Western blot - PAPD5 Rabbit pAb (A15885)}

Western blot - PAPD5 Rabbit pAb (A15885)

Western blot analysis of various lysates using PAPD5 Rabbit pAb (A15885) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A15885 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TENT4B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TENT4B. (Distance between topics and target gene indicate popularity.) TENT4B

* Data provided by citexs.com, for reference only.

Publishing research using A15885? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order