Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Osteopontin Rabbit pAb (A1499)

Publications (13) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Osteopontin Rabbit pAb (A1499)

Western blot analysis of lysates from Rat kidney, using Osteopontin Rabbit pAb (A1499) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

You may also interested in:

Overview

Product name Osteopontin Rabbit pAb
Catalog No. A1499
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human Osteopontin (NP_001035147.1).
Sequence NDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI
Gene ID 6696
Swiss prot P10451
Synonyms OPN; BNSP; BSPI; ETA-1; Osteopontin
Calculated MW 35kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat kidney
Cellular location Secreted
Customer validation

IHC (Homo sapiens, Rattus norvegicus, Mus musculus)

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

ELISA (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Osteopontin Rabbit pAb images

ABclonal:Western blot - Osteopontin Rabbit pAb (A1499)}

Western blot - Osteopontin Rabbit pAb (A1499)

Western blot analysis of lysates from Rat kidney, using Osteopontin Rabbit pAb (A1499) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Inquire About This Product

Submit your question about A1499 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SPP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SPP1. (Distance between topics and target gene indicate popularity.) SPP1

* Data provided by citexs.com, for reference only.

Publishing research using A1499? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order