Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

OTX2 Rabbit pAb (A14036)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Immunohistochemistry - OTX2 Rabbit pAb (A14036)

Immunohistochemistry analysis of paraffin-embedded rat brain using OTX2 Antibody (A14036) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - OTX2 Rabbit pAb (A14036)

Immunohistochemistry analysis of paraffin-embedded mouse brain using OTX2 Antibody (A14036) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - OTX2 Rabbit pAb (A14036)

Immunofluorescence analysis of mouse brain cells using OTX2 antibody (A14036) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name OTX2 Rabbit pAb
Catalog No. A14036
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-280 of human OTX2 (NP_068374.1).
Sequence TPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNA
Gene ID 5015
Swiss prot P32243
Synonyms CPHD6; MCOPS5; OTX2
Calculated MW 32kDa
Observed MW Refer to figures

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

OTX2 Rabbit pAb images

ABclonal:Immunohistochemistry - OTX2 Rabbit pAb (A14036)}

Immunohistochemistry - OTX2 Rabbit pAb (A14036)

Immunohistochemistry analysis of paraffin-embedded rat brain using OTX2 Antibody (A14036) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - OTX2 Rabbit pAb (A14036)}

Immunohistochemistry - OTX2 Rabbit pAb (A14036)

Immunohistochemistry analysis of paraffin-embedded mouse brain using OTX2 Antibody (A14036) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - OTX2 Rabbit pAb (A14036)}

Immunofluorescence - OTX2 Rabbit pAb (A14036)

Immunofluorescence analysis of mouse brain cells using OTX2 antibody (A14036) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A14036 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on OTX2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to OTX2. (Distance between topics and target gene indicate popularity.) OTX2

* Data provided by citexs.com, for reference only.

Publishing research using A14036? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order