Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

OSR2 Rabbit pAb (A18271)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - OSR2 Rabbit pAb (A18271)

Western blot analysis of lysates from 293T cells, using OSR2 Rabbit pAb (A18271) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name OSR2 Rabbit pAb
Catalog No. A18271
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors (Lan et al., 2004 [PubMed 15175245]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human OSR2 (NP_001135934.1).
Sequence MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLRRHSLTHTPRQDF
Gene ID 116039
Swiss prot Q8N2R0
Synonyms OSR2
Calculated MW 36kDa
Observed MW 38kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T
Cellular location nucleus

Research Area

OSR2 Rabbit pAb images

ABclonal:Western blot - OSR2 Rabbit pAb (A18271)}

Western blot - OSR2 Rabbit pAb (A18271)

Western blot analysis of lysates from 293T cells, using OSR2 Rabbit pAb (A18271) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A18271 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on OSR2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to OSR2. (Distance between topics and target gene indicate popularity.) OSR2

* Data provided by citexs.com, for reference only.

Publishing research using A18271? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order