Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Neuropilin-1 (NRP1) Rabbit pAb (A6210)

Publications (2) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Neuropilin-1 (NRP1) Rabbit pAb (A6210)

Western blot analysis of extracts of U-251MG cells, using Neuropilin-1 (Neuropilin-1 (NRP1)) antibody (A6210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name Neuropilin-1 (NRP1) Rabbit pAb
Catalog No. A6210
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 824-923 of human Neuropilin-1 (NRP1) (NP_003864.5).
Sequence IDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA
Gene ID 8829
Swiss prot O14786
Synonyms NP1; NRP; BDCA4; CD304; VEGF165R; Neuropilin-1 (NRP1)
Calculated MW 103kDa
Observed MW 103kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-251MG
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein
Customer validation

IHC (Mus musculus)

WB (Mus musculus)

Research Area

Neuropilin-1 (NRP1) Rabbit pAb images

ABclonal:Western blot - Neuropilin-1 (NRP1) Rabbit pAb (A6210)}

Western blot - Neuropilin-1 (NRP1) Rabbit pAb (A6210)

Western blot analysis of extracts of U-251MG cells, using Neuropilin-1 (Neuropilin-1 (NRP1)) antibody (A6210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A6210 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NRP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NRP1. (Distance between topics and target gene indicate popularity.) NRP1

* Data provided by citexs.com, for reference only.

Publishing research using A6210? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order