Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

NeuN Rabbit mAb (A19086)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - NeuN Rabbit mAb (A19086)

Western blot analysis of various lysates using NeuN Rabbit mAb (A19086) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - NeuN Rabbit mAb (A19086)

Immunofluorescence analysis of paraffin-embedded mouse brain, using NeuN Rabbit mAb (A19086) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NeuN Rabbit mAb (A19086)

Confocal imaging of paraffin-embedded mouse brain using NeuN Rabbit mAb (A19086, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.

ABclonal:Immunofluorescence - NeuN Rabbit mAb (A19086)

Confocal imaging of paraffin-embedded rat brain using NeuN Rabbit mAb (A19086, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.

You may also interested in:

Overview

Product name NeuN Rabbit mAb
Catalog No. A19086
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0202

Background

This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3).
Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
Gene ID 146713
Swiss prot A6NFN3
Synonyms FOX3; NEUN; FOX-3; HRNBP3; NeuN
Calculated MW 34kDa
Observed MW 46-55kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus
Customer validation

IF (Rattus norvegicus)

IHC (Rattus norvegicus)

assess the cell populations in the culture (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NeuN Rabbit mAb images

ABclonal:Western blot - NeuN Rabbit mAb (A19086)}

Western blot - NeuN Rabbit mAb (A19086)

Western blot analysis of various lysates using NeuN Rabbit mAb (A19086) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - NeuN Rabbit mAb (A19086)}

Immunofluorescence - NeuN Rabbit mAb (A19086)

Immunofluorescence analysis of paraffin-embedded mouse brain, using NeuN Rabbit mAb (A19086) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NeuN Rabbit mAb (A19086)}

Immunofluorescence - NeuN Rabbit mAb (A19086)

Confocal imaging of paraffin-embedded mouse brain using NeuN Rabbit mAb (A19086, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.
ABclonal:Immunofluorescence - NeuN Rabbit mAb (A19086)}

Immunofluorescence - NeuN Rabbit mAb (A19086)

Confocal imaging of paraffin-embedded rat brain using NeuN Rabbit mAb (A19086, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.

Inquire About This Product

Submit your question about A19086 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RBFOX3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RBFOX3. (Distance between topics and target gene indicate popularity.) RBFOX3

* Data provided by citexs.com, for reference only.

Publishing research using A19086? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order