Publications (5) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Mouse, Rat
Product name | NeuN Rabbit mAb |
---|---|
Catalog No. | A19086 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0202 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3). |
---|---|
Sequence | MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR |
Gene ID | 146713 |
Swiss prot | A6NFN3 |
Synonyms | FOX3; NEUN; FOX-3; HRNBP3; NeuN |
Calculated MW | 34kDa |
Observed MW | 46-55kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cytoplasm, Nucleus |
Customer validation | IF (Rattus norvegicus) IHC (Rattus norvegicus) assess the cell populations in the culture (Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19086 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on RBFOX3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to RBFOX3. (Distance between topics and target gene indicate popularity.) RBFOX3
* Data provided by citexs.com, for reference only.
Publishing research using A19086? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.