Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NRN1L Rabbit pAb (A16594)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NRN1L Rabbit pAb (A16594)

Western blot analysis of various lysates using NRN1L Rabbit pAb (A16594) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name NRN1L Rabbit pAb
Catalog No. A16594
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is extracellular and enhances both neurite growth and neuronal survival. The encoded protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 39-139 of human NRN1L (Q496H8).
Sequence PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA
Gene ID 123904
Swiss prot Q496H8
Synonyms UNQ2446; cpg15-2; MRCC2446; NRN1L
Calculated MW 18kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF-7, Mouse brain, Mouse bone marrow
Cellular location Cell membrane, GPI-anchor, Lipid-anchor

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

NRN1L Rabbit pAb images

ABclonal:Western blot - NRN1L Rabbit pAb (A16594)}

Western blot - NRN1L Rabbit pAb (A16594)

Western blot analysis of various lysates using NRN1L Rabbit pAb (A16594) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A16594 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NRN1L. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NRN1L. (Distance between topics and target gene indicate popularity.) NRN1L

* Data provided by citexs.com, for reference only.

Publishing research using A16594? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order