Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KD Validated] NQO1 Rabbit mAb (A19586)

Publications (36) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KD Validated] NQO1 Rabbit mAb (A19586)

Western blot analysis of extracts of various lysates, using NQO1 antibody (A19586) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KD Validated] NQO1 Rabbit mAb (A19586)

Western blot analysis of extracts from wild type (WT) and NQO1 knockdown (KD) HeLa cells, using NQO1 antibody (A19586) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)

Confocal imaging of paraffin-embedded human stomach using [KD Validated] NQO1 Rabbit mAb (A19586, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)

Confocal imaging of paraffin-embedded mouse stomach using [KD Validated] NQO1 Rabbit mAb (A19586, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)

Confocal imaging of paraffin-embedded rat stomach using [KD Validated] NQO1 Rabbit mAb (A19586, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

You may also interested in:

Overview

Product name [KD Validated] NQO1 Rabbit mAb
Catalog No. A19586
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC56753

Background

This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NQO1 (P15559).
Sequence MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIF
Gene ID 1728
Swiss prot P15559
Synonyms DTD; QR1; DHQU; DIA4; NMOR1; NMORI; [KD Validated] NQO1
Calculated MW 31kDa
Observed MW 31kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IF/ICC MouseRat
Recommended dilution
  • WB 1:5000 - 1:20000
  • IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Hep G2, HeLa, Mouse Stomach, Rat Lung, Rat Stomach
Cellular location Cytoplasm
Customer validation

WB (Mus musculus, Homo sapiens, Vaccinium dunalianum, Rattus norvegicus, Sus scrofa, Bos taurus)

IF (Mus musculus)

IHC (Mus musculus)

RT-qPCR (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] NQO1 Rabbit mAb images

ABclonal:Western blot - [KD Validated] NQO1 Rabbit mAb (A19586)}

Western blot - [KD Validated] NQO1 Rabbit mAb (A19586)

Western blot analysis of extracts of various lysates, using NQO1 antibody (A19586) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KD Validated] NQO1 Rabbit mAb (A19586)}

Western blot - [KD Validated] NQO1 Rabbit mAb (A19586)

Western blot analysis of extracts from wild type (WT) and NQO1 knockdown (KD) HeLa cells, using NQO1 antibody (A19586) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)}

Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)

Confocal imaging of paraffin-embedded human stomach using [KD Validated] NQO1 Rabbit mAb (A19586, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)}

Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)

Confocal imaging of paraffin-embedded mouse stomach using [KD Validated] NQO1 Rabbit mAb (A19586, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)}

Immunofluorescence - [KD Validated] NQO1 Rabbit mAb (A19586)

Confocal imaging of paraffin-embedded rat stomach using [KD Validated] NQO1 Rabbit mAb (A19586, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Inquire About This Product

Submit your question about A19586 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NQO1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NQO1. (Distance between topics and target gene indicate popularity.) NQO1

* Data provided by citexs.com, for reference only.

Publishing research using A19586? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order