Review (1)Publication (1) Datasheet SDS COA
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition
Reactivity:Human, Rat
Product name | NODAL Rabbit pAb |
---|---|
Catalog No. | A9902 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 198-347 of human NODAL (NP_060525.3). |
---|---|
Sequence | SNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL |
Gene ID | 4838 |
Swiss prot | Q96S42 |
Synonyms | HTX5 |
Calculated MW | 40kDa |
Observed MW | 44kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | SH-SY5Y, HepG2, 293T, Rat liver |
Cellular location | Secreted |
Customer validation | IHC(Human glioma tissue) WB(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A9902 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on NODAL. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to NODAL. (Distance between topics and target gene indicate popularity.) NODAL
* Data provided by citexs.com, for reference only.
Publishing research using A9902? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.