Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

NMDAR1 Rabbit mAb (A11699)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - NMDAR1 Rabbit mAb (A11699)

Western blot analysis of lysates from Mouse brain, using NMDAR1 Rabbit mAb (A11699) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - NMDAR1 Rabbit mAb (A11699)

Confocal imaging of Mouse brain using NMDAR1 Rabbit mAb (A11699, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.

ABclonal:Immunofluorescence - NMDAR1 Rabbit mAb (A11699)

Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using NMDAR1 Rabbit mAb (A11699) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - NMDAR1 Rabbit mAb (A11699)

Immunofluorescence analysis of paraffin-embedded Rat brain tissue using NMDAR1 Rabbit mAb (A11699) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

You may also interested in:

Overview

Product name NMDAR1 Rabbit mAb
Catalog No. A11699
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0684

Background

The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NMDAR1 (Q05586).
Sequence SRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
Gene ID 2902
Swiss prot Q05586
Synonyms NR1; MRD8; GluN1; NMDA1; DEE101; NDHMSD; NDHMSR; NMD-R1; NMDAR1
Calculated MW 105kDa
Observed MW 120kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouseRat
WB Mouse
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain
Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, postsynaptic density, synapse
Customer validation

WB (Rattus norvegicus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NMDAR1 Rabbit mAb images

ABclonal:Western blot - NMDAR1 Rabbit mAb (A11699)}

Western blot - NMDAR1 Rabbit mAb (A11699)

Western blot analysis of lysates from Mouse brain, using NMDAR1 Rabbit mAb (A11699) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - NMDAR1 Rabbit mAb (A11699)}

Immunofluorescence - NMDAR1 Rabbit mAb (A11699)

Confocal imaging of Mouse brain using NMDAR1 Rabbit mAb (A11699, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.
ABclonal:Immunofluorescence - NMDAR1 Rabbit mAb (A11699)}

Immunofluorescence - NMDAR1 Rabbit mAb (A11699)

Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using NMDAR1 Rabbit mAb (A11699) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - NMDAR1 Rabbit mAb (A11699)}

Immunofluorescence - NMDAR1 Rabbit mAb (A11699)

Immunofluorescence analysis of paraffin-embedded Rat brain tissue using NMDAR1 Rabbit mAb (A11699) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Inquire About This Product

Submit your question about A11699 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GRIN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GRIN1. (Distance between topics and target gene indicate popularity.) GRIN1

* Data provided by citexs.com, for reference only.

Publishing research using A11699? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order