Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NKX2-5 Rabbit pAb (A5651)

Publications (2) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NKX2-5 Rabbit pAb (A5651)

Western blot analysis of extracts of various cell lines, using NKX2-5 antibody (A5651) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.

You may also interested in:

Overview

Product name NKX2-5 Rabbit pAb
Catalog No. A5651
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NKX2-5 (NP_004378.1).
Sequence MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRA
Gene ID 1482
Swiss prot P52952
Synonyms CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1; NKX2-5
Calculated MW 35kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse heart, Mouse brain, Rat heart
Cellular location Nucleus
Customer validation

WB (Homo sapiens)

Research Area

NKX2-5 Rabbit pAb images

ABclonal:Western blot - NKX2-5 Rabbit pAb (A5651)}

Western blot - NKX2-5 Rabbit pAb (A5651)

Western blot analysis of extracts of various cell lines, using NKX2-5 antibody (A5651) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.

Inquire About This Product

Submit your question about A5651 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NKX2-5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NKX2-5. (Distance between topics and target gene indicate popularity.) NKX2-5

* Data provided by citexs.com, for reference only.

Publishing research using A5651? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order