Review (1)Publications (42) Datasheet SDS COA
Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat, Monkey
Product name | NF-kB p65/RelA Rabbit mAb |
---|---|
Catalog No. | A19653 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51086 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-κB p65 (Q04206). |
---|---|
Sequence | LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS |
Gene ID | 5970 |
Swiss prot | Q04206 |
Synonyms | NFKB3; p65; NF-kB p65; RELA; CMCU |
Calculated MW | 65kDa |
Observed MW | 65KDa |
Reactivity | Human, Mouse, Rat, Monkey |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | MCF7, 293T, Mouse spleen, Mouse liver, HeLa, NIH/3T3, Mouse lung, PC-12 |
Cellular location | Cytoplasm, Nucleus |
Customer validation | (RPMI-8226、PC-3、HepG2、Hela、U2-OS、Jurkat、MOLT-4) WB(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Homo sapiens) IHC(Rattus norvegicus, A. baumannii) WB(Homo sapiens) IF(Rattus norvegicus, Mus musculus ) WB,IF(Rattus norvegicus, Mus musculus) IP(Mus musculus ) (Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A19653 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on RELA. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to RELA. (Distance between topics and target gene indicate popularity.) RELA
* Data provided by citexs.com, for reference only.
Publishing research using A19653? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.