Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NEUROG3 Rabbit pAb (A16526)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NEUROG3 Rabbit pAb (A16526)

Western blot analysis of lysates from Rat large intestine, using NEUROG3 Rabbit pAb (A16526) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

You may also interested in:

Overview

Product name NEUROG3 Rabbit pAb
Catalog No. A16526
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a basic helix-loop-helix (bHLH) transcription factor involved in neurogenesis. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of congenital malabsorptive diarrhea 4 (DIAR4).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 144-214 of human NEUROG3 (NP_066279.2).
Sequence HSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLGATFSACLSPGSLAFSDFL
Gene ID 50674
Swiss prot Q9Y4Z2
Synonyms ngn3; Atoh5; NGN-3; Math4B; bHLHa7; NEUROG3
Calculated MW 23kDa
Observed MW 30kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat large intestine
Cellular location Nucleus

Research Area

NEUROG3 Rabbit pAb images

ABclonal:Western blot - NEUROG3 Rabbit pAb (A16526)}

Western blot - NEUROG3 Rabbit pAb (A16526)

Western blot analysis of lysates from Rat large intestine, using NEUROG3 Rabbit pAb (A16526) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Inquire About This Product

Submit your question about A16526 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NEUROG3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NEUROG3. (Distance between topics and target gene indicate popularity.) NEUROG3

* Data provided by citexs.com, for reference only.

Publishing research using A16526? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order