Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

NEDD8 Rabbit mAb (A22568)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NEDD8 Rabbit mAb (A22568)

Western blot analysis of various lysates, using NEDD8 antibody (A22568) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 150s.

You may also interested in:

Overview

Product name NEDD8 Rabbit mAb
Catalog No. A22568
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC58460

Background

Enables ubiquitin protein ligase binding activity. Acts upstream of or within protein neddylation. Located in cytosol and nucleoplasm. Biomarker of Parkinson's disease and malignant astrocytoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NEDD8 (NP_006147.1).
Sequence MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Gene ID 4738
Swiss prot Q15843
Synonyms NEDD-8; NEDD8
Calculated MW 9kDa
Observed MW 9kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, 293T, RAW264.7, NIH/3T3, C6, Mouse brain
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

NEDD8 Rabbit mAb images

ABclonal:Western blot - NEDD8 Rabbit mAb (A22568)}

Western blot - NEDD8 Rabbit mAb (A22568)

Western blot analysis of various lysates, using NEDD8 antibody (A22568) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 150s.

Inquire About This Product

Submit your question about A22568 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NEDD8. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NEDD8. (Distance between topics and target gene indicate popularity.) NEDD8

* Data provided by citexs.com, for reference only.

Publishing research using A22568? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order