Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

N-Cadherin Rabbit pAb (A0433)

Review (1) Publications (24) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - N-Cadherin Rabbit pAb (A0433)

Western blot analysis of Mouse heart, using N-Cadherin antibody (A0433) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - N-Cadherin Rabbit pAb (A0433)

Immunohistochemistry analysis of paraffin-embedded mouse heart using N-Cadherin Rabbit pAb (A0433) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - N-Cadherin Rabbit pAb (A0433)

Immunohistochemistry analysis of paraffin-embedded rat heart using N-Cadherin Rabbit pAb (A0433) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for N-Cadherin Rabbit pAb(A0433)

You may also interested in:

Overview

Product name N-Cadherin Rabbit pAb
Catalog No. A0433
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 807-906 of human N-Cadherin (NP_001783.2).
Sequence RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Gene ID 1000
Swiss prot P19022
Synonyms CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325; N-Cadherin
Calculated MW 100kDa
Observed MW 140kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse heart
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

WB (U87MG, Homo sapiens, Mus musculus)

ICC (Homo sapiens)

IHC (Homo sapiens)

IHC (Mus musculus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

N-Cadherin Rabbit pAb images

ABclonal:Western blot - N-Cadherin Rabbit pAb (A0433)}

Western blot - N-Cadherin Rabbit pAb (A0433)

Western blot analysis of Mouse heart, using N-Cadherin antibody (A0433) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - N-Cadherin Rabbit pAb (A0433)}

Immunohistochemistry - N-Cadherin Rabbit pAb (A0433)

Immunohistochemistry analysis of paraffin-embedded mouse heart using N-Cadherin Rabbit pAb (A0433) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - N-Cadherin Rabbit pAb (A0433)}

Immunohistochemistry - N-Cadherin Rabbit pAb (A0433)

Immunohistochemistry analysis of paraffin-embedded rat heart using N-Cadherin Rabbit pAb (A0433) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A0433

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0433 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDH2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDH2. (Distance between topics and target gene indicate popularity.) CDH2

* Data provided by citexs.com, for reference only.

Publishing research using A0433? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order