Review (1) Publications (24) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Mouse, Rat
Product name | N-Cadherin Rabbit pAb |
---|---|
Catalog No. | A0433 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 807-906 of human N-Cadherin (NP_001783.2). |
---|---|
Sequence | RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD |
Gene ID | 1000 |
Swiss prot | P19022 |
Synonyms | CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325; N-Cadherin |
Calculated MW | 100kDa |
Observed MW | 140kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | Mouse heart |
Cellular location | Cell membrane, Single-pass type I membrane protein |
Customer validation | WB (U87MG, Homo sapiens, Mus musculus) ICC (Homo sapiens) IHC (Homo sapiens) IHC (Mus musculus) IHC (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0433 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CDH2. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CDH2. (Distance between topics and target gene indicate popularity.) CDH2
* Data provided by citexs.com, for reference only.
Publishing research using A0433? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.