Reviews (2)Publications (3) Datasheet
Product name | NCAM1 / CD56 Rabbit pAb |
---|---|
Catalog No. | A7913 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2). |
---|---|
Sequence | LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA |
Gene ID | 4684 |
Swiss prot | P13591 |
Synonyms | CD56; MSK39; NCAM; NCAM1; NCAM1 /CD56 |
Calculated MW | 40kDa/73kDa/80kDa/83kDa/93kDa/94kDa |
Observed MW | 160kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | Mouse brain, Mouse spinal cord, Rat brain |
Cellular location | Cell membrane, GPI-anchor, Lipid-anchor, Secreted, Single-pass type I membrane protein |
Customer validation | (mouse brain, Rat hippocampus) WB(Homo sapiens) IHC(Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at [email protected]
Submit your question about A7913 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A7913? Please let us know so that we can cite the reference in this datasheet.