Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NCAM1 / CD56 Rabbit pAb (A7913)

Reviews (2) Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NCAM1 / CD56 Rabbit pAb (A7913)

Western blot analysis of various lysates using NCAM1 / CD56 Rabbit pAb (A7913) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - NCAM1 / CD56 Rabbit pAb (A7913)

Western blot analysis of lysates from SH-SY5Y cells using NCAM1 / CD56 Rabbit pAb(A7913) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - NCAM1 / CD56 Rabbit pAb (A7913)

Immunohistochemistry analysis of NCAM1 / CD56 in paraffin-embedded mouse brain tissue using NCAM1 / CD56 Rabbit pAb (A7913) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - NCAM1 / CD56 Rabbit pAb (A7913)

Immunohistochemistry analysis of NCAM1 / CD56 in paraffin-embedded rat brain tissue using NCAM1 / CD56 Rabbit pAb (A7913) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - NCAM1 / CD56 Rabbit pAb (A7913)

Immunofluorescence analysis of rat brain cells using NCAM1 / CD56 Rabbit pAb (A7913) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NCAM1 / CD56 Rabbit pAb (A7913)

Immunofluorescence analysis of SH-SY5Y cells using NCAM1 / CD56 Rabbit pAb (A7913) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for NCAM1 / CD56 Rabbit pAb(A7913)
Review
ABclonal: review for NCAM1 / CD56 Rabbit pAb(A7913)

You may also interested in:

Overview

Product name NCAM1 / CD56 Rabbit pAb
Catalog No. A7913
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein plays a role in the development of the nervous system by regulating neurogenesis, neurite outgrowth, and cell migration. This protein is also involved in the expansion of T lymphocytes, B lymphocytes and natural killer (NK) cells which play an important role in immune surveillance. This protein plays a role in signal transduction by interacting with fibroblast growth factor receptors, N-cadherin and other components of the extracellular matrix and by triggering signalling cascades involving FYN-focal adhesion kinase (FAK), mitogen-activated protein kinase (MAPK), and phosphatidylinositol 3-kinase (PI3K). One prominent isoform of this gene, cell surface molecule CD56, plays a role in several myeloproliferative disorders such as acute myeloid leukemia and differential expression of this gene is associated with differential disease progression. For example, increased expression of CD56 is correlated with lower survival in acute myeloid leukemia patients whereas increased severity of COVID-19 is correlated with decreased abundance of CD56-expressing NK cells in peripheral blood. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 / CD56 (NP_851996.2).
Sequence LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA
Gene ID 4684
Swiss prot P13591
Synonyms CD56; NCAM; MSK39; NCAM1 / CD56
Calculated MW 95kDa
Observed MW 120-220kDa/

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SH-SY5Y, Mouse brain, Rat brain, Mouse brain, Rat brain, SH-SY5Y
Cellular location Cell membrane, GPI-anchor, Lipid-anchor, Secreted, Single-pass type I membrane protein
Customer validation

WB (mouse brain, Rat hippocampusHomo sapiens, Homo sapiens, Chlorocebus sabaeus)

IHC (Mus musculus)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NCAM1 / CD56 Rabbit pAb images

ABclonal:Western blot - NCAM1 / CD56 Rabbit pAb (A7913)}

Western blot - NCAM1 / CD56 Rabbit pAb (A7913)

Western blot analysis of various lysates using NCAM1 / CD56 Rabbit pAb (A7913) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - NCAM1 / CD56 Rabbit pAb (A7913)}

Western blot - NCAM1 / CD56 Rabbit pAb (A7913)

Western blot analysis of lysates from SH-SY5Y cells using NCAM1 / CD56 Rabbit pAb(A7913) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - NCAM1 / CD56 Rabbit pAb (A7913)}

Immunohistochemistry - NCAM1 / CD56 Rabbit pAb (A7913)

Immunohistochemistry analysis of NCAM1 / CD56 in paraffin-embedded mouse brain tissue using NCAM1 / CD56 Rabbit pAb (A7913) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - NCAM1 / CD56 Rabbit pAb (A7913)}

Immunohistochemistry - NCAM1 / CD56 Rabbit pAb (A7913)

Immunohistochemistry analysis of NCAM1 / CD56 in paraffin-embedded rat brain tissue using NCAM1 / CD56 Rabbit pAb (A7913) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunofluorescence - NCAM1 / CD56 Rabbit pAb (A7913)}

Immunofluorescence - NCAM1 / CD56 Rabbit pAb (A7913)

Immunofluorescence analysis of rat brain cells using NCAM1 / CD56 Rabbit pAb (A7913) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NCAM1 / CD56 Rabbit pAb (A7913)}

Immunofluorescence - NCAM1 / CD56 Rabbit pAb (A7913)

Immunofluorescence analysis of SH-SY5Y cells using NCAM1 / CD56 Rabbit pAb (A7913) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A7913

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7913 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NCAM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NCAM1. (Distance between topics and target gene indicate popularity.) NCAM1

* Data provided by citexs.com, for reference only.

Publishing research using A7913? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order