Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

NBS1/NBN Rabbit mAb (A4197)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - NBS1/NBN Rabbit mAb (A4197)

Western blot analysis of lysates from PC-3 cells, using NBS1/NBN Rabbit mAb (A4197) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - NBS1/NBN Rabbit mAb (A4197)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg NBS1/NBN antibody (A4197). Western blot was performed from the immunoprecipitate using NBS1/NBN antibody (A4197) at a dilution of 1:1000.

You may also interested in:

Overview

Product name NBS1/NBN Rabbit mAb
Catalog No. A4197
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0926

Background

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 655-754 of human NBS1/NBN (O60934).
Sequence LLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Gene ID 4683
Swiss prot O60934
Synonyms ATV; NBS; P95; NBS1; AT-V1; AT-V2; NBS1/NBN
Calculated MW 85kDa
Observed MW 95kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples 239T, HeLa
Cellular location Chromosome, Nucleus, PML body, Telomere

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NBS1/NBN Rabbit mAb images

ABclonal:Western blot - NBS1/NBN Rabbit mAb (A4197)}

Western blot - NBS1/NBN Rabbit mAb (A4197)

Western blot analysis of lysates from PC-3 cells, using NBS1/NBN Rabbit mAb (A4197) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunoprecipitation - NBS1/NBN Rabbit mAb (A4197)}

Immunoprecipitation - NBS1/NBN Rabbit mAb (A4197)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg NBS1/NBN antibody (A4197). Western blot was performed from the immunoprecipitate using NBS1/NBN antibody (A4197) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A4197 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NBN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NBN. (Distance between topics and target gene indicate popularity.) NBN

* Data provided by citexs.com, for reference only.

Publishing research using A4197? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order