Products > Catalog Antibodies > Polyclonal Antibodies

NBR1 Rabbit pAb (A3949)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Mouse, Rat

Immunofluorescence analysis of NIH/3T3 cells using NBR1 Rabbit pAb (A3949) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using NBR1 Rabbit pAb (A3949) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	NBR1 Rabbit pAb
Catalog No.	A3949
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled-coil motif, which is present in many genes with transformation potential. It functions as a specific autophagy receptor for the selective autophagic degradation of peroxisomes by forming intracellular inclusions with ubiquitylated autophagic substrates. This gene is located on a region of chromosome 17q21.1 that is in close proximity to the BRCA1 tumor suppressor gene. Alternative splicing of this gene results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human NBR1 (NP_005890.2).
Sequence	MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRL
Gene ID	4077
Swiss prot	Q14596
Synonyms	NBR1; 1A1-3B; IAI3B; M17S2; MIG19
Calculated MW	103kDa/107kDa
Observed MW	120KDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	IF 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Immunofluorescence
Positive samples
Cellular location	Cytoplasm, Cytoplasmic vesicle, Lysosome, M line, autophagosome, myofibril, sarcomere
Customer validation	WB(Mus musculus) IHC(Mus musculus)