Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

NADPH oxidase 4 (NOX4) Rabbit mAb (A3656)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - NADPH oxidase 4 (NOX4) Rabbit mAb (A3656)

Western blot analysis of extracts of Mouse brain, using NADPH oxidase 4 (NOX4) Rabbit mAb (A3656) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name NADPH oxidase 4 (NOX4) Rabbit mAb
Catalog No. A3656
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0815

Background

This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 479-578 of human NADPH oxidase 4 (NOX4) (Q9NPH5).
Sequence LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Gene ID 50507
Swiss prot Q9NPH5
Synonyms KOX; KOX-1; RENOX; NADPH oxidase 4 (NOX4)
Calculated MW 67kDa
Observed MW 67kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain
Cellular location Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Nucleus, focal adhesion, nucleolus
Customer validation

WB (Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NADPH oxidase 4 (NOX4) Rabbit mAb images

ABclonal:Western blot - NADPH oxidase 4 (NOX4) Rabbit mAb (A3656)}

Western blot - NADPH oxidase 4 (NOX4) Rabbit mAb (A3656)

Western blot analysis of extracts of Mouse brain, using NADPH oxidase 4 (NOX4) Rabbit mAb (A3656) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A3656 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NOX4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NOX4. (Distance between topics and target gene indicate popularity.) NOX4

* Data provided by citexs.com, for reference only.

Publishing research using A3656? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order