Publications (3) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Mouse, Rat
Product name | NADPH oxidase 4 (NOX4) Rabbit mAb |
---|---|
Catalog No. | A3656 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0815 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 479-578 of human NADPH oxidase 4 (NOX4) (Q9NPH5). |
---|---|
Sequence | LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS |
Gene ID | 50507 |
Swiss prot | Q9NPH5 |
Synonyms | KOX; KOX-1; RENOX; NADPH oxidase 4 (NOX4) |
Calculated MW | 67kDa |
Observed MW | 67kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Mouse brain |
Cellular location | Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Nucleus, focal adhesion, nucleolus |
Customer validation | WB (Mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A3656 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on NOX4. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to NOX4. (Distance between topics and target gene indicate popularity.) NOX4
* Data provided by citexs.com, for reference only.
Publishing research using A3656? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.