Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Myogenin Rabbit pAb (A6664)

Publications (11) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Myogenin Rabbit pAb (A6664)

Western blot analysis of lysates from Rat skeletal muscle, using Myogenin Rabbit pAb (A6664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - Myogenin Rabbit pAb (A6664)

Western blot analysis of various lysates, using Myogenin Rabbit pAb (A6664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): 293T, NIH/3T3
Exposure time: 30s.

You may also interested in:

Overview

Product name Myogenin Rabbit pAb
Catalog No. A6664
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-224 of human Myogenin (NP_002470.2).
Sequence MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Gene ID 4656
Swiss prot P15173
Synonyms MYF4; myf-4; bHLHc3; Myogenin
Calculated MW 25kDa
Observed MW 34kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Rat skeletal muscle, RD, Mouse skeletal muscle, Rat heart
Cellular location Nucleus
Customer validation

WB (Mus musculus, Bos taurus, Rattus norvegicus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Myogenin Rabbit pAb images

ABclonal:Western blot - Myogenin Rabbit pAb (A6664)}

Western blot - Myogenin Rabbit pAb (A6664)

Western blot analysis of lysates from Rat skeletal muscle, using Myogenin Rabbit pAb (A6664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - Myogenin Rabbit pAb (A6664)}

Western blot - Myogenin Rabbit pAb (A6664)

Western blot analysis of various lysates, using Myogenin Rabbit pAb (A6664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): 293T, NIH/3T3
Exposure time: 30s.

Inquire About This Product

Submit your question about A6664 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYOG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYOG. (Distance between topics and target gene indicate popularity.) MYOG

* Data provided by citexs.com, for reference only.

Publishing research using A6664? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order