Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Myelin oligodendrocyte glycoprotein Rabbit pAb (A5353)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Myelin oligodendrocyte glycoprotein Rabbit pAb (A5353)

Western blot analysis of extracts of various cell lines, using Myelin oligodendrocyte glycoprotein antibody (A5353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name Myelin oligodendrocyte glycoprotein Rabbit pAb
Catalog No. A5353
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-154 of human Myelin oligodendrocyte glycoprotein (NP_996532.2).
Sequence GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Gene ID 4340
Swiss prot Q16653
Synonyms BTN6; BTNL11; MOGIG2; NRCLP7; Myelin oligodendrocyte glycoprotein
Calculated MW 28kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain, Rat brain
Cellular location Cell membrane, Multi-pass membrane protein, Single-pass type I membrane protein
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Myelin oligodendrocyte glycoprotein Rabbit pAb images

ABclonal:Western blot - Myelin oligodendrocyte glycoprotein Rabbit pAb (A5353)}

Western blot - Myelin oligodendrocyte glycoprotein Rabbit pAb (A5353)

Western blot analysis of extracts of various cell lines, using Myelin oligodendrocyte glycoprotein antibody (A5353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A5353 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MOG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MOG. (Distance between topics and target gene indicate popularity.) MOG

* Data provided by citexs.com, for reference only.

Publishing research using A5353? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order