Publications (3) Datasheet SDS
Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Mouse, Rat
Product name | Myelin Basic Protein Rabbit mAb |
---|---|
Catalog No. | A11162 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0535 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686). |
---|---|
Sequence | GFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR |
Gene ID | 4155 |
Swiss prot | P02686 |
Synonyms | MBP; myelin basic protein |
Calculated MW | 18kDa |
Observed MW | 14-23KDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cytoplasmic side, Myelin membrane, Nucleus, Peripheral membrane protein |
Customer validation | WB(Mus musculus, Arabidopsis thaliana, Rattus norvegicus) IHC(Rattus norvegicus) |
Submit your question about A11162 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on MBP. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to MBP. (Distance between topics and target gene indicate popularity.) MBP
* Data provided by citexs.com, for reference only.
Publishing research using A11162? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.