Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MyD88 Rabbit pAb (A0980)

Review (1) Publications (39) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MyD88 Rabbit pAb (A0980)

Western blot analysis of various lysates using MyD88 Rabbit pAb (A0980) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - MyD88 Rabbit pAb (A0980)

Immunofluorescence analysis of U2OS cells using MyD88 Rabbit pAb (A0980) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for MyD88 Rabbit pAb(A0980)

You may also interested in:

Overview

Product name MyD88 Rabbit pAb
Catalog No. A0980
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 20-140 of human MyD88 (NP_002459.2).
Sequence GAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEK
Gene ID 4615
Swiss prot Q99836
Synonyms WM1; IMD68; MYD88D; MyD88
Calculated MW 33kDa
Observed MW 33kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples A-549, Mouse lung, Mouse uterus, Rat lung
Cellular location Cytoplasm
Customer validation

WB (CAL27Mus musculus, Rattus norvegicus, Mus musculus, King Charles Spaniel, Homo sapiens, Bos taurus)

IF (Mus musculus)

IHC (Rattus norvegicus, Mus musculus, Homo sapiens)

IB (Homo sapiens)

IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MyD88 Rabbit pAb images

ABclonal:Western blot - MyD88 Rabbit pAb (A0980)}

Western blot - MyD88 Rabbit pAb (A0980)

Western blot analysis of various lysates using MyD88 Rabbit pAb (A0980) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - MyD88 Rabbit pAb (A0980)}

Immunofluorescence - MyD88 Rabbit pAb (A0980)

Immunofluorescence analysis of U2OS cells using MyD88 Rabbit pAb (A0980) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A0980

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0980 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYD88. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYD88. (Distance between topics and target gene indicate popularity.) MYD88

* Data provided by citexs.com, for reference only.

Publishing research using A0980? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order