Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal: - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg MonoMethyl-Histone H3-K9 antibody (A20734) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of H3K9me1 in representative gene loci (MYOD1), as shown in figure.

ABclonal:Western blot - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Western blot analysis of various lysates using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Dot Blot - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-K9 antibody (A20734) at 1:1000 dilution.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human cervix cancer tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human colon carcinoma tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded Human lung adenocarcinoma tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human tonsil tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse colon tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse lung tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse spleen tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse testis tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat brain tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat colon tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat kidney tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat spleen tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Confocal imaging of U-2 OS cells using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Chromatin Immunoprecipitation - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Chromatin immunoprecipitation analysis of extracts from HeLa cells, using MonoMethyl-Histone H3-K9 antibody (A20734) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name MonoMethyl-Histone H3-K9 Rabbit mAb
Catalog No. A20734
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2677

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen A synthetic monomethylated peptide around K9 of human Histone H3 (P68431).
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID 82908350
Swiss prot Q16695P68431
Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K9
Calculated MW 16kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications Testing results
IF/ICC HumanRat
WB HumanMouseRat
IHC-P HumanMouseRat
Recommended dilution
  • DB 1:500 - 1:1000
  • WB 1:500 - 1:1000
  • IHC-P 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
  • ChIP 5μg antibody for 5μg-10μg of Chromatin
  • CUT&Tag 10⁵ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa nuclear extract, NIH/3T3 nuclear extract, C6 nuclear extract
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

MonoMethyl-Histone H3-K9 Rabbit mAb images

ABclonal: - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

- MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg MonoMethyl-Histone H3-K9 antibody (A20734) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of H3K9me1 in representative gene loci (MYOD1), as shown in figure.
ABclonal:Western blot - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Western blot - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Western blot analysis of various lysates using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Dot Blot - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Dot Blot - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-K9 antibody (A20734) at 1:1000 dilution.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human cervix cancer tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human colon carcinoma tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded Human lung adenocarcinoma tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human tonsil tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse colon tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse lung tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse spleen tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse testis tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat brain tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat colon tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat kidney tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunohistochemistry - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat spleen tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunofluorescence - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Immunofluorescence - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Confocal imaging of U-2 OS cells using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
ABclonal:Chromatin Immunoprecipitation - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)}

Chromatin Immunoprecipitation - MonoMethyl-Histone H3-K9 Rabbit mAb (A20734)

Chromatin immunoprecipitation analysis of extracts from HeLa cells, using MonoMethyl-Histone H3-K9 antibody (A20734) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A20734 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Histone H3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Histone H3. (Distance between topics and target gene indicate popularity.) Histone H3

* Data provided by citexs.com, for reference only.

Publishing research using A20734? Please let us know so that we can cite the reference in this datasheet.

Antibodies (114)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order