Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg MonoMethyl-Histone H3-K9 antibody (A20734) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of H3K9me1 in representative gene loci (MYOD1), as shown in figure.
Western blot analysis of various lysates using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-K9 antibody (A20734) at 1:1000 dilution.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human cervix cancer tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human colon carcinoma tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded Human lung adenocarcinoma tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded human tonsil tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse colon tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse lung tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse spleen tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded mouse testis tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat brain tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat colon tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat kidney tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of MonoMethyl-Histone H3-K9 in paraffin-embedded rat spleen tissue using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Confocal imaging of U-2 OS cells using MonoMethyl-Histone H3-K9 Rabbit mAb (A20734, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Product name | MonoMethyl-Histone H3-K9 Rabbit mAb |
---|---|
Catalog No. | A20734 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2677 |
Immunogen | A synthetic monomethylated peptide around K9 of human Histone H3 (P68431). |
---|---|
Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
Gene ID | 82908350 |
Swiss prot | Q16695P68431 |
Synonyms | H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K9 |
Calculated MW | 16kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | Testing results |
IF/ICC | HumanRat |
WB | HumanMouseRat |
IHC-P | HumanMouseRat |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa nuclear extract, NIH/3T3 nuclear extract, C6 nuclear extract |
Cellular location | Chromosome, Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A20734 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on Histone H3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to Histone H3. (Distance between topics and target gene indicate popularity.) Histone H3
* Data provided by citexs.com, for reference only.
Publishing research using A20734? Please let us know so that we can cite the reference in this datasheet.
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K4 Rabbit pAb
A2357
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K9 Rabbit pAb
A2360
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K14 Rabbit pAb
A7254
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K18 Rabbit pAb
A7257
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K56 Rabbit pAb
A7256
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb
A2421
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K36 Rabbit pAb
A2364
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K27 Rabbit pAb
A2361
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-S10 Rabbit pAb
AP0840
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K79 Rabbit pAb
A2369
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Asymmetric DiMethyl-Histone H3-R2 Rabbit pAb
A3155
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Symmetric DiMethyl-Histone H3-R8 Rabbit pAb
A2374
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K36 Rabbit mAb
A20379
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K27 Rabbit mAb
A2771
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K4 Rabbit pAb
A16078
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
citrulline-Histone H3-R2/R8/R17 Rabbit pAb
A18298
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K9/K14/K18/K23/K27 Rabbit pAb
A17917
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Lactic acid-Histone H3-K18 Rabbit pAb
A18807
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-S10 Rabbit mAb
AP0002
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-R26 Rabbit pAb
A3163
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-R2 Rabbit pAb
A3154
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Symmetric DiMethyl-Histone H3-R2 Rabbit pAb
A2373
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Asymmetric DiMethyl-Histone H3-R26 Rabbit pAb
A2375
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K4 Rabbit pAb
A17019
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K36 Rabbit pAb
A16077
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Lactic acid-Histone H3-K14 Rabbit pAb
A18808
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Lactic acid-Histone H3-K27 Rabbit pAb
A18825
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K36 Rabbit pAb
A20566
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K4 Rabbit mAb
A22225
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K23 Rabbit mAb
A2770
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-R8 Rabbit pAb
A3156
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-S28 Rabbit pAb
AP0097
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-T11 Rabbit pAb
AP0093
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
succinylation-Histone H3-K79 Rabbit pAb
A17903
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K56 Rabbit pAb
A7262
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K64 Rabbit pAb
A7259
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K36 Rabbit mAb
A23944
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
DiMethyl-Histone H3-K14 Rabbit pAb
A5278
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K14 Rabbit pAb
A5279
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K14 Rabbit pAb
A5277
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Asymmetric DiMethyl-Histone H3-R8 Rabbit pAb
A3157
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Symmetric DiMethyl-Histone H3-R26 Rabbit pAb
A3153
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-R17 Rabbit pAb
A3151
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Symmetric DiMethyl-Histone H3-R17 Rabbit pAb
A3152
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Asymmetric DiMethyl-Histone H3-R2 Rabbit pAb
A20732
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K4/K9/K14/K18/K23/K27 Rabbit pAb
A21295
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K27 Rabbit mAb
A22396
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-S28 Rabbit pAb
AP0839
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-T3 Rabbit pAb
AP0846
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K9/K14/K18/K23/K27 Rabbit pAb
A21299
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-S10/T11 Rabbit pAb
AP0896
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-T32 Rabbit pAb
AP0897
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-T6 Rabbit pAb
AP0899
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-T45 Rabbit pAb
AP0898
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K23 Rabbit pAb
A18154
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-R2 Rabbit mAb
A19645
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb
A17899
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3.3-T3 Rabbit mAb
AP1152
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K36 Rabbit pAb
A20185
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K27 Rabbit pAb
A20184
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Symmetric DiMethyl-Histone H3-R8 Rabbit pAb
A20820
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K79 Rabbit pAb
A20821
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
DiMethyl-Histone H3-K79 Rabbit pAb
A20822
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Symmetric DiMethyl-Histone H3-R8 Rabbit mAb
A21207
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Lactic acid-Histone H3-K18 Rabbit mAb
A21214
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K79 Rabbit mAb
A21223
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K27 Rabbit mAb
A22006
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K4 Rabbit mAb
A22078
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K9 Rabbit mAb
A22079
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
DiMethyl-Histone H3-K36 Rabbit mAb
A22087
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
DiMethyl-Histone H3-K79 Rabbit mAb
A22142
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Asymmetric DiMethyl-Histone H3-R8 Rabbit mAb
A22144
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K56 Rabbit mAb
A22145
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K27 Rabbit mAb
A22170
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
DiMethyl-Histone H3-K36 Rabbit mAb
A22221
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K4 Rabbit mAb
A22224
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K4 Rabbit mAb
A22226
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Symmetric DiMethyl-Histone H3-R17 Rabbit mAb
A22291
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
TriMethyl-Histone H3-K9 Rabbit mAb
A22297
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K18 Rabbit mAb
A22566
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K9 Rabbit mAb
A22567
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
MonoMethyl-Histone H3-K36 Rabbit mAb
A22863
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Phospho-Histone H3-S28 Rabbit mAb
AP1431
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Acetyl-Histone H3-K4 Rabbit mAb
A24341
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
* For research use only. Not for therapeutic or diagnostic purposes.