Reviews (2) Publications (28) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Mitofusin 2 Rabbit pAb |
---|---|
Catalog No. | A12771 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 70-260 of human Mitofusin 2 (NP_055689.1). |
---|---|
Sequence | TTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRW |
Gene ID | 9927 |
Swiss prot | O95140 |
Synonyms | HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B; Mitofusin 2 |
Calculated MW | 86kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | Rat brain |
Cellular location | Mitochondrion outer membrane, Multi-pass membrane protein |
Customer validation | WB (Human bone marrow cancer cellRattus norvegicus, Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa, Bos taurus, Cyprinus carpio) IHC (Human bone marrow cancer cellHomo sapiens, Mus musculus) IF (Homo sapiens, Mus musculus, Cyprinus carpio) IP (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A12771 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on MFN2. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to MFN2. (Distance between topics and target gene indicate popularity.) MFN2
* Data provided by citexs.com, for reference only.
Publishing research using A12771? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.