Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Mitofusin 2 Rabbit pAb (A12771)

Reviews (2) Publications (28) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Mitofusin 2 Rabbit pAb (A12771)

Western blot analysis of Rat brain, using Mitofusin 2 antibody (A12771) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Mitofusin 2 Rabbit pAb (A12771)

Immunofluorescence analysis of 293T cells using Mitofusin 2 Rabbit pAb (A12771) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Mitofusin 2 Rabbit pAb (A12771)

Immunofluorescence analysis of HeLa cells using Mitofusin 2 Rabbit pAb (A12771) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for Mitofusin 2 Rabbit pAb(A12771)
Review
ABclonal: review for Mitofusin 2 Rabbit pAb(A12771)

You may also interested in:

Overview

Product name Mitofusin 2 Rabbit pAb
Catalog No. A12771
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-260 of human Mitofusin 2 (NP_055689.1).
Sequence TTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRW
Gene ID 9927
Swiss prot O95140
Synonyms HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B; Mitofusin 2
Calculated MW 86kDa
Observed MW 80kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Rat brain
Cellular location Mitochondrion outer membrane, Multi-pass membrane protein
Customer validation

WB (Human bone marrow cancer cellRattus norvegicus, Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa, Bos taurus, Cyprinus carpio)

IHC (Human bone marrow cancer cellHomo sapiens, Mus musculus)

IF (Homo sapiens, Mus musculus, Cyprinus carpio)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Mitofusin 2 Rabbit pAb images

ABclonal:Western blot - Mitofusin 2 Rabbit pAb (A12771)}

Western blot - Mitofusin 2 Rabbit pAb (A12771)

Western blot analysis of Rat brain, using Mitofusin 2 antibody (A12771) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - Mitofusin 2 Rabbit pAb (A12771)}

Immunofluorescence - Mitofusin 2 Rabbit pAb (A12771)

Immunofluorescence analysis of 293T cells using Mitofusin 2 Rabbit pAb (A12771) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Mitofusin 2 Rabbit pAb (A12771)}

Immunofluorescence - Mitofusin 2 Rabbit pAb (A12771)

Immunofluorescence analysis of HeLa cells using Mitofusin 2 Rabbit pAb (A12771) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A12771

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A12771 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MFN2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MFN2. (Distance between topics and target gene indicate popularity.) MFN2

* Data provided by citexs.com, for reference only.

Publishing research using A12771? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order