Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Mitofusin-1/MFN1 Rabbit pAb (A9880)

Reviews (2) Publications (38) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Mitofusin-1/MFN1 Rabbit pAb (A9880)

Western blot analysis of various lysates, using Mitofusin-1/MFN1 Rabbit pAb (A9880) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Mitofusin-1/MFN1 Rabbit pAb (A9880)

Western blot analysis of lysates from Rat heart, using Mitofusin-1/MFN1 Rabbit pAb (A9880) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Mitofusin-1/MFN1 Rabbit pAb (A9880)

Immunofluorescence analysis of U2OS cells using Mitofusin-1/MFN1 Rabbit pAb (A9880) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Mitofusin-1/MFN1 Rabbit pAb(A9880)
Review
ABclonal: review for Mitofusin-1/MFN1 Rabbit pAb(A9880)

You may also interested in:

Overview

Product name Mitofusin-1/MFN1 Rabbit pAb
Catalog No. A9880
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 622-741 of human Mitofusin-1/MFN1 (NP_284941.2).
Sequence YGALYLYERLSWTTHAKERAFKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES
Gene ID 55669
Swiss prot Q8IWA4
Synonyms hfzo1; hfzo2; Mitofusin-1/MFN1
Calculated MW 84kDa
Observed MW 84kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, T-47D, Rat heart
Cellular location Cytoplasm, Mitochondrion outer membrane, Multi-pass membrane protein
Customer validation

IHC (Human bone marrow cancer cellHomo sapiens, Mus musculus, Rattus norvegicus)

WB (Human bone marrow cancer cellRattus norvegicus, Homo sapiens, Gallus gallus, Mus musculus, Rattus norvegicus, Bos taurus, Anser cygnoides, Cyprinus carpio)

IF (Mus musculus, Rattus norvegicus, Cyprinus carpio)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Mitofusin-1/MFN1 Rabbit pAb images

ABclonal:Western blot - Mitofusin-1/MFN1 Rabbit pAb (A9880)}

Western blot - Mitofusin-1/MFN1 Rabbit pAb (A9880)

Western blot analysis of various lysates, using Mitofusin-1/MFN1 Rabbit pAb (A9880) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Mitofusin-1/MFN1 Rabbit pAb (A9880)}

Western blot - Mitofusin-1/MFN1 Rabbit pAb (A9880)

Western blot analysis of lysates from Rat heart, using Mitofusin-1/MFN1 Rabbit pAb (A9880) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - Mitofusin-1/MFN1 Rabbit pAb (A9880)}

Immunofluorescence - Mitofusin-1/MFN1 Rabbit pAb (A9880)

Immunofluorescence analysis of U2OS cells using Mitofusin-1/MFN1 Rabbit pAb (A9880) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A9880

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A9880 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MFN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MFN1. (Distance between topics and target gene indicate popularity.) MFN1

* Data provided by citexs.com, for reference only.

Publishing research using A9880? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order