Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Mannose Receptor/CD206 Rabbit pAb (A8301)

Publications (25) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - Mannose Receptor/CD206 Rabbit pAb (A8301)

Western blot analysis of various lysates using Mannose Receptor/CD206 Rabbit pAb (A8301) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Negative control (NC): Jurkat.
Exposuretime: 30s.

You may also interested in:

Overview

Product name Mannose Receptor/CD206 Rabbit pAb
Catalog No. A8301
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 610-860 of human Mannose Receptor/CD206 (NP_002429.1).
Sequence GLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAY
Gene ID 4360
Swiss prot P22897
Synonyms MMR; hMR; CD206; MRC1L1; CLEC13D; CLEC13DL; bA541I19.1; Mannose Receptor/CD206
Calculated MW 166kDa
Observed MW 190-250kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat lung
Cellular location Cell membrane, Endosome membrane, Single-pass type I membrane protein
Customer validation

IF (Homo sapiens, Mus musculus, Sus domesticus)

WB (Mus musculus, Homo sapiens, Rattus norvegicus)

FC (Homo sapiens)

IHC (Rattus norvegicus, Mus musculus, Homo sapiens)

IF/ICC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Mannose Receptor/CD206 Rabbit pAb images

ABclonal:Western blot - Mannose Receptor/CD206 Rabbit pAb (A8301)}

Western blot - Mannose Receptor/CD206 Rabbit pAb (A8301)

Western blot analysis of various lysates using Mannose Receptor/CD206 Rabbit pAb (A8301) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Negative control (NC): Jurkat.
Exposuretime: 30s.

Inquire About This Product

Submit your question about A8301 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MRC1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MRC1. (Distance between topics and target gene indicate popularity.) MRC1

* Data provided by citexs.com, for reference only.

Publishing research using A8301? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order