Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

MYL12B Rabbit mAb (A9387)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MYL12B Rabbit mAb (A9387)

Western blot analysis of extracts of various cell lines, using (A9387) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - MYL12B Rabbit mAb (A9387)

Western blot analysis of extracts of various cell lines, using (A9387) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - MYL12B Rabbit mAb (A9387)

Immunofluorescence analysis of Jurkat cells using MYL12B antibody (A9387) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name MYL12B Rabbit mAb
Catalog No. A9387
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2712

Background

The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 73-172 of human MYL12B (O14950).
Sequence MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Gene ID 103910
Swiss prot O14950
Synonyms MLC-B; MRLC2; MYL12B
Calculated MW 20kDa
Observed MW 20kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC Human
WB HumanMouseRat
Recommended dilution
  • WB 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples K-562, U-87MG, Mouse large intestine, Mouse lung, Mouse kidney, Rat lung, Rat brain
Cellular location cell cortex, cytoplasm, cytosol, extracellular exosome, myofibril, Z disc

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MYL12B Rabbit mAb images

ABclonal:Western blot - MYL12B Rabbit mAb (A9387)}

Western blot - MYL12B Rabbit mAb (A9387)

Western blot analysis of extracts of various cell lines, using (A9387) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - MYL12B Rabbit mAb (A9387)}

Western blot - MYL12B Rabbit mAb (A9387)

Western blot analysis of extracts of various cell lines, using (A9387) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - MYL12B Rabbit mAb (A9387)}

Immunofluorescence - MYL12B Rabbit mAb (A9387)

Immunofluorescence analysis of Jurkat cells using MYL12B antibody (A9387) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A9387 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYL12B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYL12B. (Distance between topics and target gene indicate popularity.) MYL12B

* Data provided by citexs.com, for reference only.

Publishing research using A9387? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order