Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

N-Myc/MYCN Rabbit pAb (A0499)

Review (1) Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - N-Myc/MYCN Rabbit pAb (A0499)

Western blot analysis of extracts of HeLa cells, using N-Myc/MYCN antibody (A0499) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - N-Myc/MYCN Rabbit pAb (A0499)

Immunohistochemistry analysis of paraffin-embedded mouse brain using N-Myc/MYCN antibody (A0499) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - N-Myc/MYCN Rabbit pAb (A0499)

Immunohistochemistry analysis of paraffin-embedded rat brain using N-Myc/MYCN antibody (A0499) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - N-Myc/MYCN Rabbit pAb (A0499)

Immunofluorescence analysis of mouse brain using N-Myc/MYCN Rabbit pAb (A0499) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - N-Myc/MYCN Rabbit pAb (A0499)

Immunofluorescence analysis of rat brain using N-Myc/MYCN Rabbit pAb (A0499) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for N-Myc/MYCN Rabbit pAb(A0499)

You may also interested in:

Overview

Product name N-Myc/MYCN Rabbit pAb
Catalog No. A0499
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 168-267 of human N-Myc/MYCN (NP_005369.2).
Sequence AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED
Gene ID 4613
Swiss prot P04198
Synonyms NMYC; ODED; MODED; N-myc; bHLHe37; MYCNsORF; MYCNsPEP; N-Myc/MYCN
Calculated MW 50kDa
Observed MW 62kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa
Cellular location Nucleus
Customer validation

IHC (Human neuroblastoma)

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

N-Myc/MYCN Rabbit pAb images

ABclonal:Western blot - N-Myc/MYCN Rabbit pAb (A0499)}

Western blot - N-Myc/MYCN Rabbit pAb (A0499)

Western blot analysis of extracts of HeLa cells, using N-Myc/MYCN antibody (A0499) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - N-Myc/MYCN Rabbit pAb (A0499)}

Immunohistochemistry - N-Myc/MYCN Rabbit pAb (A0499)

Immunohistochemistry analysis of paraffin-embedded mouse brain using N-Myc/MYCN antibody (A0499) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - N-Myc/MYCN Rabbit pAb (A0499)}

Immunohistochemistry - N-Myc/MYCN Rabbit pAb (A0499)

Immunohistochemistry analysis of paraffin-embedded rat brain using N-Myc/MYCN antibody (A0499) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - N-Myc/MYCN Rabbit pAb (A0499)}

Immunofluorescence - N-Myc/MYCN Rabbit pAb (A0499)

Immunofluorescence analysis of mouse brain using N-Myc/MYCN Rabbit pAb (A0499) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - N-Myc/MYCN Rabbit pAb (A0499)}

Immunofluorescence - N-Myc/MYCN Rabbit pAb (A0499)

Immunofluorescence analysis of rat brain using N-Myc/MYCN Rabbit pAb (A0499) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A0499

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0499 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MYCN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MYCN. (Distance between topics and target gene indicate popularity.) MYCN

* Data provided by citexs.com, for reference only.

Publishing research using A0499? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order