Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

MUC2 Rabbit mAb (A4767)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MUC2 Rabbit mAb (A4767)

Western blot analysis of various lysates using MUC2 Rabbit mAb (A4767) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - MUC2 Rabbit mAb (A4767)

Western blot analysis of lysates from Rat large intestine, using MUC2 Rabbit mAb (A4767) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - MUC2 Rabbit mAb (A4767)

Immunohistochemistry analysis of MUC2 in paraffin-embedded human colon carcinoma using MUC2 Rabbit mAb (A4767) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MUC2 Rabbit mAb (A4767)

Immunohistochemistry analysis of MUC2 in paraffin-embedded human colon using MUC2 Rabbit mAb (A4767) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name MUC2 Rabbit mAb
Catalog No. A4767
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1012

Background

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 5000-5100 of human MUC2 (Q02817).
Sequence PDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG
Gene ID 4583
Swiss prot Q02817
Synonyms MLP; SMUC; MUC-2; MUC2
Calculated MW 551kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanMouseRat
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, SGC-7901, Mouse stomach, Rat large intestine
Cellular location Secreted
Customer validation

WB (Mus musculus, mmu)

IF (Sus scrofa)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MUC2 Rabbit mAb images

ABclonal:Western blot - MUC2 Rabbit mAb (A4767)}

Western blot - MUC2 Rabbit mAb (A4767)

Western blot analysis of various lysates using MUC2 Rabbit mAb (A4767) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - MUC2 Rabbit mAb (A4767)}

Western blot - MUC2 Rabbit mAb (A4767)

Western blot analysis of lysates from Rat large intestine, using MUC2 Rabbit mAb (A4767) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Immunohistochemistry - MUC2 Rabbit mAb (A4767)}

Immunohistochemistry - MUC2 Rabbit mAb (A4767)

Immunohistochemistry analysis of MUC2 in paraffin-embedded human colon carcinoma using MUC2 Rabbit mAb (A4767) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MUC2 Rabbit mAb (A4767)}

Immunohistochemistry - MUC2 Rabbit mAb (A4767)

Immunohistochemistry analysis of MUC2 in paraffin-embedded human colon using MUC2 Rabbit mAb (A4767) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A4767 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MUC2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MUC2. (Distance between topics and target gene indicate popularity.) MUC2

* Data provided by citexs.com, for reference only.

Publishing research using A4767? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order