Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MT-ND1 Rabbit pAb (A5250)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - MT-ND1 Rabbit pAb (A5250)

Western blot analysis of various lysates using MT-ND1 Rabbit pAb (A5250) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name MT-ND1 Rabbit pAb
Catalog No. A5250
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable triplet codon-amino acid adaptor activity. Predicted to act upstream of or within translation. Predicted to be located in mitochondrion. Orthologous to human MT-TI (mitochondrially encoded tRNA-Ile (AUU/C)).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse MT-ND1 (NP_904328.1).
Sequence MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNL
Gene ID 17733
Swiss prot P03888
Synonyms TrnI; MT-ND1
Calculated MW 36kDa
Observed MW 36kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, HeLa
Cellular location Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

MT-ND1 Rabbit pAb images

ABclonal:Western blot - MT-ND1 Rabbit pAb (A5250)}

Western blot - MT-ND1 Rabbit pAb (A5250)

Western blot analysis of various lysates using MT-ND1 Rabbit pAb (A5250) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A5250 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on mt-Ti. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to mt-Ti. (Distance between topics and target gene indicate popularity.) mt-Ti

* Data provided by citexs.com, for reference only.

Publishing research using A5250? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order