Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MT-CYB Rabbit pAb (A17966)

Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MT-CYB Rabbit pAb (A17966)

Western blot analysis of various lysates using MT-CYB Rabbit pAb (A17966) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - MT-CYB Rabbit pAb (A17966)

Immunohistochemistry analysis of MT-CYB in paraffin-embedded mouse kidney tissue using MT-CYB Rabbit pAb (A17966) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MT-CYB Rabbit pAb (A17966)

Immunohistochemistry analysis of MT-CYB in paraffin-embedded rat liver tissue using MT-CYB Rabbit pAb (A17966) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - MT-CYB Rabbit pAb (A17966)

Immunohistochemistry analysis of MT-CYB in paraffin-embedded human thyroid cancer tissue using MT-CYB Rabbit pAb (A17966) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - MT-CYB Rabbit pAb (A17966)

Immunofluorescence analysis of L929 cells using MT-CYB Rabbit pAb (A17966) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name MT-CYB Rabbit pAb
Catalog No. A17966
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable metal ion binding activity. Predicted to be involved in several processes, including electron transport coupled proton transport; response to cobalamin; and response to glucagon. Located in mitochondrion. Implicated in ovarian carcinoma and urinary bladder cancer.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MT-CYB (YP_003024038.1).
Sequence RGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFL
Gene ID 4519
Swiss prot P00156
Synonyms MTCYB; CYTB; MT-CYB
Calculated MW 43kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples mouse heart, rat heart
Cellular location mitochondrial inner membrane, mitochondrial respiratory chain complex III, mitochondrion
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MT-CYB Rabbit pAb images

ABclonal:Western blot - MT-CYB Rabbit pAb (A17966)}

Western blot - MT-CYB Rabbit pAb (A17966)

Western blot analysis of various lysates using MT-CYB Rabbit pAb (A17966) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - MT-CYB Rabbit pAb (A17966)}

Immunohistochemistry - MT-CYB Rabbit pAb (A17966)

Immunohistochemistry analysis of MT-CYB in paraffin-embedded mouse kidney tissue using MT-CYB Rabbit pAb (A17966) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MT-CYB Rabbit pAb (A17966)}

Immunohistochemistry - MT-CYB Rabbit pAb (A17966)

Immunohistochemistry analysis of MT-CYB in paraffin-embedded rat liver tissue using MT-CYB Rabbit pAb (A17966) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - MT-CYB Rabbit pAb (A17966)}

Immunohistochemistry - MT-CYB Rabbit pAb (A17966)

Immunohistochemistry analysis of MT-CYB in paraffin-embedded human thyroid cancer tissue using MT-CYB Rabbit pAb (A17966) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - MT-CYB Rabbit pAb (A17966)}

Immunofluorescence - MT-CYB Rabbit pAb (A17966)

Immunofluorescence analysis of L929 cells using MT-CYB Rabbit pAb (A17966) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A17966 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MT-CYB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MT-CYB. (Distance between topics and target gene indicate popularity.) MT-CYB

* Data provided by citexs.com, for reference only.

Publishing research using A17966? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order