Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MRP4/ABCC4 Rabbit pAb (A2198)

Review (1) Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MRP4/ABCC4 Rabbit pAb (A2198)

Western blot analysis of extracts of various cell lines, using MRP4/ABCC4 antibody (A2198) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded rat testis using MRP4/ABCC4 antibody (A2198) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded mouse testis using MRP4/ABCC4 antibody (A2198) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded human oophoroma using MRP4/ABCC4 Rabbit pAb (A2198) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded human prostate cancer using MRP4/ABCC4 Rabbit pAb (A2198) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for MRP4/ABCC4 Rabbit pAb(A2198)

You may also interested in:

Overview

Product name MRP4/ABCC4 Rabbit pAb
Catalog No. A2198
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1067-1325 of human MRP4/ABCC4 (NP_005836.2).
Sequence SQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL
Gene ID 10257
Swiss prot O15439
Synonyms MRP4; MOATB; MOAT-B; MRP4/ABCC4
Calculated MW 150kDa
Observed MW 140-200kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, HeLa Cytoplasm extracts, 293T
Cellular location Membrane, Multi-pass membrane protein
Customer validation

(Mouse H2.35 cell)

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MRP4/ABCC4 Rabbit pAb images

ABclonal:Western blot - MRP4/ABCC4 Rabbit pAb (A2198)}

Western blot - MRP4/ABCC4 Rabbit pAb (A2198)

Western blot analysis of extracts of various cell lines, using MRP4/ABCC4 antibody (A2198) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)}

Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded rat testis using MRP4/ABCC4 antibody (A2198) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)}

Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded mouse testis using MRP4/ABCC4 antibody (A2198) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)}

Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded human oophoroma using MRP4/ABCC4 Rabbit pAb (A2198) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)}

Immunohistochemistry - MRP4/ABCC4 Rabbit pAb (A2198)

Immunohistochemistry analysis of paraffin-embedded human prostate cancer using MRP4/ABCC4 Rabbit pAb (A2198) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A2198

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2198 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ABCC4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ABCC4. (Distance between topics and target gene indicate popularity.) ABCC4

* Data provided by citexs.com, for reference only.

Publishing research using A2198? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order