Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

MRE11 Rabbit mAb (A4222)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - MRE11 Rabbit mAb (A4222)

Western blot analysis of various lysates using MRE11 Rabbit mAb (A4222) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Chromatin Immunoprecipitation - MRE11 Rabbit mAb (A4222)

Chromatin immunoprecipitation analysis of extracts of LNCaP cells, using Mre11 antibody (A4222) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review
ABclonal: review for MRE11 Rabbit mAb(A4222)

You may also interested in:

Overview

Product name MRE11 Rabbit mAb
Catalog No. A4222
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0931

Background

This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human MRE11 (P49959).
Sequence RHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEE
Gene ID 4361
Swiss prot P49959
Synonyms ATLD; HNGS1; MRE11A; MRE11B; MRE11
Calculated MW 81kDa
Observed MW 81kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:2000
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, Mouse testis
Cellular location Nucleus
Customer validation

(NCl-N87 、RAMOS 、293T 、PC-3 、Hela)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MRE11 Rabbit mAb images

ABclonal:Western blot - MRE11 Rabbit mAb (A4222)}

Western blot - MRE11 Rabbit mAb (A4222)

Western blot analysis of various lysates using MRE11 Rabbit mAb (A4222) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Chromatin Immunoprecipitation - MRE11 Rabbit mAb (A4222)}

Chromatin Immunoprecipitation - MRE11 Rabbit mAb (A4222)

Chromatin immunoprecipitation analysis of extracts of LNCaP cells, using Mre11 antibody (A4222) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Submit an review for A4222

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A4222 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MRE11. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MRE11. (Distance between topics and target gene indicate popularity.) MRE11

* Data provided by citexs.com, for reference only.

Publishing research using A4222? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order