Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MOB4 Rabbit pAb (A4590)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MOB4 Rabbit pAb (A4590)

Western blot analysis of various lysates using MOB4 Rabbit pAb (A4590) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - MOB4 Rabbit pAb (A4590)

Immunohistochemistry analysis of MOB4 in paraffin-embedded rat ovary using MOB4 Rabbit pAb (A4590) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MOB4 Rabbit pAb (A4590)

Immunohistochemistry analysis of MOB4 in paraffin-embedded human oophoroma using MOB4 Rabbit pAb (A4590) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name MOB4 Rabbit pAb
Catalog No. A4590
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human MOB4 (NP_056202.2).
Sequence MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
Gene ID 25843
Swiss prot Q9Y3A3
Synonyms 2C4D; MOB1; MOB3; PHOCN; PREI3; CGI-95; MOBKL3; MOB4
Calculated MW 26kDa
Observed MW 26kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A-549, MCF7, Mouse brain, Mouse heart, Mouse kidney, Rat spleen, Rat brain
Cellular location Cytoplasm, Golgi apparatus, Golgi stack membrane, Membrane, Peripheral membrane protein, perinuclear region
Customer validation

WB (Homo sapiens)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MOB4 Rabbit pAb images

ABclonal:Western blot - MOB4 Rabbit pAb (A4590)}

Western blot - MOB4 Rabbit pAb (A4590)

Western blot analysis of various lysates using MOB4 Rabbit pAb (A4590) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - MOB4 Rabbit pAb (A4590)}

Immunohistochemistry - MOB4 Rabbit pAb (A4590)

Immunohistochemistry analysis of MOB4 in paraffin-embedded rat ovary using MOB4 Rabbit pAb (A4590) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MOB4 Rabbit pAb (A4590)}

Immunohistochemistry - MOB4 Rabbit pAb (A4590)

Immunohistochemistry analysis of MOB4 in paraffin-embedded human oophoroma using MOB4 Rabbit pAb (A4590) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A4590 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MOB4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MOB4. (Distance between topics and target gene indicate popularity.) MOB4

* Data provided by citexs.com, for reference only.

Publishing research using A4590? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order