Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MMP25 Rabbit pAb (A15886)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MMP25 Rabbit pAb (A15886)

Western blot analysis of various lysates using MMP25 Rabbit pAb (A15886) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - MMP25 Rabbit pAb (A15886)

Immunohistochemistry analysis of MMP25 in paraffin-embedded rat spleen using MMP25 Rabbit pAb (A15886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MMP25 Rabbit pAb (A15886)

Immunohistochemistry analysis of MMP25 in paraffin-embedded human lung cancer using MMP25 Rabbit pAb (A15886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - MMP25 Rabbit pAb (A15886)

Immunohistochemistry analysis of MMP25 in paraffin-embedded mouse spleen using MMP25 Rabbit pAb (A15886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - MMP25 Rabbit pAb (A15886)

Immunofluorescence analysis of HeLa cells using MMP25 Rabbit pAb (A15886) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - MMP25 Rabbit pAb (A15886)

Immunofluorescence analysis of L929 cells using MMP25 Rabbit pAb (A15886) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name MMP25 Rabbit pAb
Catalog No. A15886
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily, attached to the plasma membrane via a glycosylphosphatidyl inositol anchor. In response to bacterial infection or inflammation, the encoded protein is thought to inactivate alpha-1 proteinase inhibitor, a major tissue protectant against proteolytic enzymes released by activated neutrophils, facilitating the transendothelial migration of neutrophils to inflammatory sites. The encoded protein may also play a role in tumor invasion and metastasis through activation of MMP2. The gene has previously been referred to as MMP20 but has been renamed MMP25.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 321-539 of human MMP25 (NP_071913.1).
Sequence FDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQA
Gene ID 64386
Swiss prot Q9NPA2
Synonyms MMP20; MMPL1; MMP-25; MMP20A; MT6MMP; MTMMP6; MT-MMP6; MT6-MMP; MT-MMP 6; MMP25
Calculated MW 63kDa
Observed MW 75kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples A-549, HT-29, Mouse lung, Mouse liver, Rat liver
Cellular location Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor, Secreted, extracellular matrix, extracellular space

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MMP25 Rabbit pAb images

ABclonal:Western blot - MMP25 Rabbit pAb (A15886)}

Western blot - MMP25 Rabbit pAb (A15886)

Western blot analysis of various lysates using MMP25 Rabbit pAb (A15886) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - MMP25 Rabbit pAb (A15886)}

Immunohistochemistry - MMP25 Rabbit pAb (A15886)

Immunohistochemistry analysis of MMP25 in paraffin-embedded rat spleen using MMP25 Rabbit pAb (A15886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MMP25 Rabbit pAb (A15886)}

Immunohistochemistry - MMP25 Rabbit pAb (A15886)

Immunohistochemistry analysis of MMP25 in paraffin-embedded human lung cancer using MMP25 Rabbit pAb (A15886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - MMP25 Rabbit pAb (A15886)}

Immunohistochemistry - MMP25 Rabbit pAb (A15886)

Immunohistochemistry analysis of MMP25 in paraffin-embedded mouse spleen using MMP25 Rabbit pAb (A15886) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - MMP25 Rabbit pAb (A15886)}

Immunofluorescence - MMP25 Rabbit pAb (A15886)

Immunofluorescence analysis of HeLa cells using MMP25 Rabbit pAb (A15886) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - MMP25 Rabbit pAb (A15886)}

Immunofluorescence - MMP25 Rabbit pAb (A15886)

Immunofluorescence analysis of L929 cells using MMP25 Rabbit pAb (A15886) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15886 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MMP25. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MMP25. (Distance between topics and target gene indicate popularity.) MMP25

* Data provided by citexs.com, for reference only.

Publishing research using A15886? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order